BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP24_F_E15
(908 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z68105-2|CAA92118.1| 270|Caenorhabditis elegans Hypothetical pr... 29 6.1
>Z68105-2|CAA92118.1| 270|Caenorhabditis elegans Hypothetical
protein F13E6.3 protein.
Length = 270
Score = 28.7 bits (61), Expect = 6.1
Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
Frame = -1
Query: 494 LKTMVLKYNFFT--CRFQVGSLIQTLVGFSTLCWHKRNRCLLQ*YLLQHPSGLGRGL*YP 321
LK ++L + F+ C F V +I + ST+C H R + Q +L++ S + +
Sbjct: 72 LKAVMLLFKLFSYYCSFSVSHIISSFRPLSTMCDHPR---IFQMHLIERASKVYKWTETA 128
Query: 320 *SVVVPD 300
S++V D
Sbjct: 129 DSIIVDD 135
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,084,229
Number of Sequences: 27780
Number of extensions: 266952
Number of successful extensions: 558
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 541
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 558
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2318293978
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -