Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP23_F_F03
         (868 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_04_0009 - 13657511-13657578,13658060-13658276,13658363-13658509     31   1.6  

>09_04_0009 - 13657511-13657578,13658060-13658276,13658363-13658509
          Length = 143

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 25/67 (37%), Positives = 32/67 (47%)
 Frame = -1

Query: 499 LAAANIRQGALAVVLPAVPGIEAVTFVNFLSAFRCLSDVVSQEVGALNVAVFAWTGTFAA 320
           LAA  +   A  V++ A     AV  V  L+A   L  V    VGAL+VAVF    T AA
Sbjct: 55  LAALTVLLVAAFVLVAAATSAAAVAAVVSLAALSALLAVAY--VGALSVAVFVVAATTAA 112

Query: 319 PVPVVDL 299
            V  + +
Sbjct: 113 TVVAITI 119


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,858,976
Number of Sequences: 37544
Number of extensions: 276334
Number of successful extensions: 685
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 672
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 685
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2432722788
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)