BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP23_F_A21
(852 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 22 6.2
AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 6.2
>M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee
homeobox-containing gene,partial cds, clone H55. ).
Length = 86
Score = 22.2 bits (45), Expect = 6.2
Identities = 12/46 (26%), Positives = 19/46 (41%)
Frame = +2
Query: 524 RHEFGRVQTILFPIYYAFNACMSLLGLLAYLRTQCLTEFENTSWIQ 661
R + R QT+ + FN ++ + CLTE + W Q
Sbjct: 12 RTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQ 57
>AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein.
Length = 735
Score = 22.2 bits (45), Expect = 6.2
Identities = 7/9 (77%), Positives = 7/9 (77%)
Frame = -2
Query: 245 PGGPAGTPP 219
PGGP G PP
Sbjct: 48 PGGPPGAPP 56
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 224,171
Number of Sequences: 438
Number of extensions: 4516
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27431202
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -