SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP21_F_L24
         (932 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    25   0.74 
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    25   1.3  
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   4.0  
EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholi...    23   5.2  
EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholi...    23   5.2  
EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholi...    23   5.2  
EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholi...    23   5.2  
EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholi...    23   5.2  
EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholi...    23   5.2  
DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholi...    23   5.2  
DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholi...    23   5.2  
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     22   9.2  

>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 25.4 bits (53), Expect = 0.74
 Identities = 10/39 (25%), Positives = 15/39 (38%)
 Frame = -3

Query: 324 DHCRHYLFPEFRFTLFDCGHNHVPRTGRRQSVQATFDXL 208
           D C  Y +    +T  DCG    P   +R   Q   + +
Sbjct: 471 DQCEEYEYVHDEYTCMDCGPGKWPHEDKRGCYQLAINHI 509


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 10/39 (25%), Positives = 15/39 (38%)
 Frame = -3

Query: 324 DHCRHYLFPEFRFTLFDCGHNHVPRTGRRQSVQATFDXL 208
           D C  Y +    +T  DCG    P   +R   Q   + +
Sbjct: 561 DQCEEYEYVYDEYTCMDCGPGKWPHEDKRGCYQLAINHI 599


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -2

Query: 196 TYRFFAPCVVGAVDY 152
           T RF+  CVV A DY
Sbjct: 467 TTRFYTACVVEAFDY 481


>EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 6 protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 342 WFPLPDDHC 316
           WFP  D HC
Sbjct: 117 WFPFDDQHC 125


>EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 5 protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 342 WFPLPDDHC 316
           WFP  D HC
Sbjct: 117 WFPFDDQHC 125


>EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 4 protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 342 WFPLPDDHC 316
           WFP  D HC
Sbjct: 117 WFPFDDQHC 125


>EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 3 protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 342 WFPLPDDHC 316
           WFP  D HC
Sbjct: 117 WFPFDDQHC 125


>EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 2 protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 342 WFPLPDDHC 316
           WFP  D HC
Sbjct: 117 WFPFDDQHC 125


>EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 1 protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 342 WFPLPDDHC 316
           WFP  D HC
Sbjct: 117 WFPFDDQHC 125


>DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 342 WFPLPDDHC 316
           WFP  D HC
Sbjct: 185 WFPFDDQHC 193


>DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 342 WFPLPDDHC 316
           WFP  D HC
Sbjct: 185 WFPFDDQHC 193


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 21.8 bits (44), Expect = 9.2
 Identities = 10/25 (40%), Positives = 12/25 (48%)
 Frame = -3

Query: 348 SEWFPLPDDHCRHYLFPEFRFTLFD 274
           S + PL +DH  HY  P      FD
Sbjct: 195 SAYTPLKEDHDDHYGVPTLEELGFD 219


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 188,309
Number of Sequences: 438
Number of extensions: 3711
Number of successful extensions: 12
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 30476628
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -