SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP21_F_A03
         (894 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    22   8.7  
AF441189-1|AAL73401.1|  134|Apis mellifera ribosomal protein 49 ...    22   8.7  
AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    22   8.7  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    22   8.7  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    22   8.7  

>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 9/20 (45%), Positives = 15/20 (75%)
 Frame = -3

Query: 196 LFRRPK*ILLNSSKSRPVKL 137
           LFR PK I +N+++ + +KL
Sbjct: 119 LFRGPKGIQINATELQKIKL 138


>AF441189-1|AAL73401.1|  134|Apis mellifera ribosomal protein 49
           protein.
          Length = 134

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 11/50 (22%), Positives = 27/50 (54%)
 Frame = +2

Query: 446 PRVVEHALRVLHKGEAAVVRVCRIS*RRADHDLPSGTRHQVRNGDRVLDI 595
           P+ +++ +R   KG+  +  +   S ++  H LP+G R  + +  + L++
Sbjct: 37  PKGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPTGFRKVLVHNVKELEV 86


>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -2

Query: 362 DWTIGGHRDGML 327
           +W +G H DG L
Sbjct: 518 EWKVGNHEDGYL 529


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -2

Query: 362 DWTIGGHRDGML 327
           +W +G H DG L
Sbjct: 433 EWKVGNHEDGYL 444


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -2

Query: 362 DWTIGGHRDGML 327
           +W +G H DG L
Sbjct: 752 EWKVGNHEDGYL 763


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 243,046
Number of Sequences: 438
Number of extensions: 5465
Number of successful extensions: 16
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28904421
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -