SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP18_F_P12
         (908 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       23   2.9  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   6.7  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   6.7  

>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 783 GPPXXPPSXNP 815
           GPP  PPS NP
Sbjct: 50  GPPGAPPSQNP 60


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 22.2 bits (45), Expect = 6.7
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = +2

Query: 278  CILRGPSPRPTLLQA 322
            C+LR  +P P +L+A
Sbjct: 1106 CVLRASTPAPVVLEA 1120


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.2 bits (45), Expect = 6.7
 Identities = 13/45 (28%), Positives = 17/45 (37%)
 Frame = +1

Query: 199 LTTARTSLILPKTTTLMETATNLSTTVHITWTLPKADLTSSLPLS 333
           +TT  T+     TTT   T  N +     T   P+ D      LS
Sbjct: 658 ITTITTTTTTTTTTTTTTTTPNTTQNASATTPPPQVDEVDDKELS 702


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 214,193
Number of Sequences: 438
Number of extensions: 4341
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29509116
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -