Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP18_F_I19
         (932 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY588474-1|AAT94401.1|  104|Apis mellifera defensin 2 protein.         23   4.0  
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    22   9.2  

>AY588474-1|AAT94401.1|  104|Apis mellifera defensin 2 protein.
          Length = 104

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = -2

Query: 199 CDVFXWRSRW 170
           CDV  W+S+W
Sbjct: 64  CDVLSWQSKW 73


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 21.8 bits (44), Expect = 9.2
 Identities = 9/34 (26%), Positives = 15/34 (44%)
 Frame = -3

Query: 207 PLIVMFLXGDLVGDTHSLLRXHFVLL*SIVCQFN 106
           P + + + GD+ G   +LL          +CQ N
Sbjct: 477 PAVNIIVKGDVAGSVEALLDIFDTYTYDTICQLN 510


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 149,022
Number of Sequences: 438
Number of extensions: 2525
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 30476628
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)