Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP18_F_I07
         (838 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      23   2.6  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   2.6  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   3.5  
EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.          23   4.6  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    22   6.1  

>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = -1

Query: 217 FFSSTVQGLIKNTKKVRHASTLSVYVSIAFPLVNTEYMLTN 95
           FF S+V    +N K  R +S ++   +I   +VNT Y   N
Sbjct: 170 FFDSSVIEEAQNLKMSRGSSVVTGMNNIETYIVNTNYSSKN 210


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 746  PPPPPXPP 769
            PPPPP PP
Sbjct: 1355 PPPPPPPP 1362



 Score = 23.4 bits (48), Expect = 2.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 749  PPPPXPPP 772
            PPPP PPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 23.4 bits (48), Expect = 2.6
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 752  PPPXPPPP 775
            PPP PPPP
Sbjct: 1355 PPPPPPPP 1362


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.0 bits (47), Expect = 3.5
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 749 PPPPXPPPP 775
           PP P PPPP
Sbjct: 338 PPKPAPPPP 346



 Score = 22.6 bits (46), Expect = 4.6
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +2

Query: 746 PPPPPXPPPP 775
           PP P  PPPP
Sbjct: 338 PPKPAPPPPP 347



 Score = 22.6 bits (46), Expect = 4.6
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +2

Query: 746 PPPPPXPPPP 775
           P P P PPPP
Sbjct: 339 PKPAPPPPPP 348


>EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.
          Length = 686

 Score = 22.6 bits (46), Expect = 4.6
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = -1

Query: 217 FFSSTVQGLIKNTKKVRHASTLSVYVSIAFPLVNTEY 107
           FF S+V    +N K  R +S ++   +I   +VNT Y
Sbjct: 170 FFDSSVIEEAQNLKMSRGSSVVTGMNNIETYIVNTNY 206


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +1

Query: 781 PPHHPXPPPT 810
           P HHP PP T
Sbjct: 463 PHHHPHPPET 472


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,028
Number of Sequences: 438
Number of extensions: 4372
Number of successful extensions: 13
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26824317
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)