BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP18_F_E15
(875 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U53583-2|AAC99555.1| 287|Homo sapiens olfactory receptor 17-210... 30 9.6
>U53583-2|AAC99555.1| 287|Homo sapiens olfactory receptor 17-210
protein.
Length = 287
Score = 30.3 bits (65), Expect = 9.6
Identities = 18/67 (26%), Positives = 32/67 (47%)
Frame = -1
Query: 635 ISNKVISEVCPSSFVVAPYLRSSXSVIV*PTLAPTSSKFQTILPLFY*LLKIFMFICLRY 456
+SN S++C SS + L++ S P++ Q LFY +L+ F+ + + Y
Sbjct: 7 LSNLSFSDLCFSSVTMPKLLQNMQSQN--PSIPFADCLAQMYFHLFYGVLESFLLVVMAY 64
Query: 455 YCRYFCC 435
+C C
Sbjct: 65 HCYVAIC 71
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,971,977
Number of Sequences: 237096
Number of extensions: 1602906
Number of successful extensions: 6552
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6368
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6552
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11159604822
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -