SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP17_F_J19
         (1016 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    25   0.100
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    27   0.36 
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              24   1.9  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
            channel protein.
          Length = 428

 Score = 24.6 bits (51), Expect(2) = 0.100
 Identities = 14/50 (28%), Positives = 16/50 (32%)
 Frame = +3

Query: 855  PPPPPPPPXXXXQXIXKQKXSXDPAPKKDXFPXXXXXXXXXXPPXXXPPP 1004
            P PPPPPP        K     D A K++              P   P P
Sbjct: 341  PAPPPPPPSSSGPDSAKLDKIFDIATKENAMLLSGRSQKSTTGPPPGPTP 390



 Score = 23.8 bits (49), Expect = 2.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 783 PXPPPPPPT 809
           P PPPPPP+
Sbjct: 341 PAPPPPPPS 349



 Score = 23.0 bits (47), Expect = 4.4
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 853 PPPPPPPPP 879
           PP P PPPP
Sbjct: 338 PPKPAPPPP 346



 Score = 23.0 bits (47), Expect = 4.4
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 853 PPPPPPPPP 879
           P P PPPPP
Sbjct: 339 PKPAPPPPP 347



 Score = 22.2 bits (45), Expect(2) = 0.100
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 852 TPPPPPPPP 878
           TPP P PPP
Sbjct: 337 TPPKPAPPP 345



 Score = 22.2 bits (45), Expect = 7.7
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 848 KXPPPPPPP 874
           K  PPPPPP
Sbjct: 340 KPAPPPPPP 348


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 26.6 bits (56), Expect = 0.36
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 854  PPPPPPPP 877
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 26.6 bits (56), Expect = 0.36
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 856  PPPPPPPP 879
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 25.0 bits (52), Expect = 1.1
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +3

Query: 774  QXXPXPPPPPPT 809
            Q  P PPPPPP+
Sbjct: 1352 QQQPPPPPPPPS 1363



 Score = 22.2 bits (45), Expect = 7.7
 Identities = 8/14 (57%), Positives = 8/14 (57%)
 Frame = +1

Query: 790  PPPPPPQKXXXAXL 831
            PPPPPP     A L
Sbjct: 1356 PPPPPPPSSGQAYL 1369


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 24.2 bits (50), Expect = 1.9
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = +3

Query: 852  TPPPPPPPPXXXXQ 893
            +P PPPPPP    Q
Sbjct: 1856 SPEPPPPPPRNHDQ 1869



 Score = 23.4 bits (48), Expect = 3.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 783  PXPPPPPP 806
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 220,967
Number of Sequences: 438
Number of extensions: 8276
Number of successful extensions: 59
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 33862920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -