BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP17_F_E16
(872 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 2.8
AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 3.7
DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 22 6.4
DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 22 6.4
DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 22 6.4
DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 22 6.4
DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 6.4
DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 6.4
DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 6.4
DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 6.4
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.4
AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 8.5
>AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A
isoform protein.
Length = 567
Score = 23.4 bits (48), Expect = 2.8
Identities = 10/39 (25%), Positives = 21/39 (53%)
Frame = +1
Query: 376 NIFILIQQNGSKNSFTLEGIWNSIMCDPHYCNSRYLLRL 492
+I Q +K+S+T+ G+ +I H+C Y +++
Sbjct: 433 SIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKV 471
>AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor
protein.
Length = 501
Score = 23.0 bits (47), Expect = 3.7
Identities = 10/25 (40%), Positives = 14/25 (56%)
Frame = -3
Query: 831 VDRAPRTSFVAISPVYIGATVYTTP 757
V R PR V +S V++GA + P
Sbjct: 151 VKRTPRRMIVYVSLVWLGAACISLP 175
>DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 22.2 bits (45), Expect = 6.4
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = +2
Query: 602 HRFHPPISP 628
+RFHPP++P
Sbjct: 160 YRFHPPLNP 168
>DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 22.2 bits (45), Expect = 6.4
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = +2
Query: 602 HRFHPPISP 628
+RFHPP++P
Sbjct: 160 YRFHPPLNP 168
>DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 22.2 bits (45), Expect = 6.4
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = +2
Query: 602 HRFHPPISP 628
+RFHPP++P
Sbjct: 160 YRFHPPLNP 168
>DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 22.2 bits (45), Expect = 6.4
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = +2
Query: 602 HRFHPPISP 628
+RFHPP++P
Sbjct: 160 YRFHPPLNP 168
>DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 22.2 bits (45), Expect = 6.4
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = +2
Query: 602 HRFHPPISP 628
+RFHPP++P
Sbjct: 164 YRFHPPLNP 172
>DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex
determiner protein.
Length = 184
Score = 22.2 bits (45), Expect = 6.4
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = +2
Query: 602 HRFHPPISP 628
+RFHPP++P
Sbjct: 169 YRFHPPLNP 177
>DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex
determiner protein.
Length = 184
Score = 22.2 bits (45), Expect = 6.4
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = +2
Query: 602 HRFHPPISP 628
+RFHPP++P
Sbjct: 169 YRFHPPLNP 177
>DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex
determiner protein.
Length = 184
Score = 22.2 bits (45), Expect = 6.4
Identities = 6/9 (66%), Positives = 9/9 (100%)
Frame = +2
Query: 602 HRFHPPISP 628
+RFHPP++P
Sbjct: 169 YRFHPPLNP 177
>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
protein.
Length = 1770
Score = 22.2 bits (45), Expect = 6.4
Identities = 8/14 (57%), Positives = 10/14 (71%)
Frame = +2
Query: 611 HPPISPTNSEEKLH 652
+P I+P N EKLH
Sbjct: 1474 YPRINPDNHNEKLH 1487
>AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase
protein.
Length = 628
Score = 21.8 bits (44), Expect = 8.5
Identities = 6/9 (66%), Positives = 7/9 (77%)
Frame = -1
Query: 356 YCAIWNEII 330
YCA WNE +
Sbjct: 573 YCAFWNEFL 581
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 209,524
Number of Sequences: 438
Number of extensions: 4293
Number of successful extensions: 14
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28280841
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -