Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP16_F_P02
         (938 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z32681-6|CAA83605.1|  257|Caenorhabditis elegans Hypothetical pr...    58   9e-09

>Z32681-6|CAA83605.1|  257|Caenorhabditis elegans Hypothetical
           protein F56F3.5 protein.
          Length = 257

 Score = 58.0 bits (134), Expect = 9e-09
 Identities = 30/62 (48%), Positives = 39/62 (62%)
 Frame = +3

Query: 102 KKVLRMKIVXQFTXKDWYDVXXPSMFSXRXVGTTPXSTVPKATXIXSEGLKGRXSELSLA 281
           KK  + K V  F+ K+WYD+  P+MF+ R VG T  +   + T I SEGLKGR  E+SL 
Sbjct: 12  KKGGKKKAVDPFSRKEWYDIKAPNMFNTRQVGKTLINRT-QGTKIASEGLKGRVFEVSLG 70

Query: 282 DL 287
           DL
Sbjct: 71  DL 72


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,177,789
Number of Sequences: 27780
Number of extensions: 91793
Number of successful extensions: 94
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 91
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 93
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2423194158
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)