SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP16_F_L21
         (882 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0162 - 1302497-1302787,1304608-1305271,1305380-1306927,130...    31   0.93 
06_01_0610 - 4415080-4415461,4415872-4416851                           31   1.6  

>08_01_0162 -
           1302497-1302787,1304608-1305271,1305380-1306927,
           1307360-1308768
          Length = 1303

 Score = 31.5 bits (68), Expect = 0.93
 Identities = 21/67 (31%), Positives = 30/67 (44%)
 Frame = -1

Query: 225 SIFLKSFHLGSGAALTAPRASTNAKTKLKIRTKFILPKFYSAGEFKIPNTISFDANAKND 46
           SI     HLG G  L+ PR   +     K+  K +LP+  S G F    T SF+ +  + 
Sbjct: 219 SILAMRLHLGYG--LSGPRHRPDYNLSYKVDLKSVLPELVSVG-FSASTTTSFELHQLHS 275

Query: 45  QILRNSL 25
               +SL
Sbjct: 276 WYFSSSL 282


>06_01_0610 - 4415080-4415461,4415872-4416851
          Length = 453

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = -3

Query: 490 WYVKYY*YNRGTH 452
           WY+ YY YNRGTH
Sbjct: 435 WYLSYYGYNRGTH 447


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,100,513
Number of Sequences: 37544
Number of extensions: 305359
Number of successful extensions: 521
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 513
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 521
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2491484208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -