SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP16_F_L14
         (894 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex det...    24   2.2  
DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex det...    24   2.2  
DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex det...    24   2.2  
DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex det...    24   2.2  
DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex det...    24   2.2  
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     23   5.0  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   5.0  
DQ325126-1|ABD14140.1|  174|Apis mellifera complementary sex det...    22   8.7  

>DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +2

Query: 293 NYSTKCNNINYIE 331
           NY   C NINYIE
Sbjct: 98  NYKQLCYNINYIE 110


>DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +2

Query: 293 NYSTKCNNINYIE 331
           NY   C NINYIE
Sbjct: 98  NYKQLCYNINYIE 110


>DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +2

Query: 293 NYSTKCNNINYIE 331
           NY   C NINYIE
Sbjct: 98  NYKQLCYNINYIE 110


>DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +2

Query: 293 NYSTKCNNINYIE 331
           NY   C NINYIE
Sbjct: 98  NYKQLCYNINYIE 110


>DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +2

Query: 293 NYSTKCNNINYIE 331
           NY   C NINYIE
Sbjct: 98  NYKQLCYNINYIE 110


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 11/38 (28%), Positives = 17/38 (44%)
 Frame = +1

Query: 364 PPXPPXNTXXTPYXGPRISPLLRVXLDPHLIXYIDEFG 477
           PP PP  T  +   G   +PL     D + +  ++E G
Sbjct: 180 PPEPPVPTVTSACVGSAYTPLKEDHDDHYGVPTLEELG 217


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 9/32 (28%), Positives = 17/32 (53%)
 Frame = -3

Query: 310  TFCGII*ALSLVPRAFAFGQGVDCWSRADDGV 215
            T  G++  L ++  AF F + V  W+ +  G+
Sbjct: 1001 TLSGVLVLLVIIVLAFVFRESVGAWAYSKYGL 1032


>DQ325126-1|ABD14140.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +2

Query: 293 NYSTKCNNINYIE 331
           NY   C NIN+IE
Sbjct: 98  NYKQLCYNINHIE 110


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,686
Number of Sequences: 438
Number of extensions: 3147
Number of successful extensions: 8
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28904421
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -