BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP16_F_H03
(913 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
02_04_0281 + 21563588-21563696,21565053-21565708,21565793-215658... 29 5.1
>02_04_0281 +
21563588-21563696,21565053-21565708,21565793-21565879,
21566487-21567461,21567640-21567786
Length = 657
Score = 29.1 bits (62), Expect = 5.1
Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
Frame = -2
Query: 414 FGTTLDCVSYEGRLNL*GNRSPSW*MKISLKYMLGTL-NNASTSGAIQREAKRLIVKNKR 238
FG+ C RLN +R+ SW + T NN T G+ +RE +L +KR
Sbjct: 117 FGSFSTCRPERDRLNRSRSRTDSWNKGVVSPNNCNTSRNNTGTGGSFEREFPQLPFDDKR 176
Query: 237 FERSQV 220
+ ++V
Sbjct: 177 QDINRV 182
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,440,614
Number of Sequences: 37544
Number of extensions: 254193
Number of successful extensions: 550
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 539
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 550
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2588957540
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -