Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP16_F_H03
         (913 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0281 + 21563588-21563696,21565053-21565708,21565793-215658...    29   5.1  

>02_04_0281 +
           21563588-21563696,21565053-21565708,21565793-21565879,
           21566487-21567461,21567640-21567786
          Length = 657

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
 Frame = -2

Query: 414 FGTTLDCVSYEGRLNL*GNRSPSW*MKISLKYMLGTL-NNASTSGAIQREAKRLIVKNKR 238
           FG+   C     RLN   +R+ SW   +       T  NN  T G+ +RE  +L   +KR
Sbjct: 117 FGSFSTCRPERDRLNRSRSRTDSWNKGVVSPNNCNTSRNNTGTGGSFEREFPQLPFDDKR 176

Query: 237 FERSQV 220
            + ++V
Sbjct: 177 QDINRV 182


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,440,614
Number of Sequences: 37544
Number of extensions: 254193
Number of successful extensions: 550
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 539
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 550
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2588957540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)