Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP16_F_G14
         (885 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    24   2.1  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    22   6.5  

>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 8/69 (11%)
 Frame = +3

Query: 186 LYKAWYRQIPYIVKDYDI-----PKS---EAQCREKLKELFIKNKHVTDIRVIDMLVIKG 341
           +YK++   I    KD ++     PKS   E  C  K  E+F       D   +   V KG
Sbjct: 453 MYKSYPNYIDKETKDMNLEISTRPKSNTVENACVLKNTEIFKDKSDWFDYSEVSKWVQKG 512

Query: 342 QMELKESVN 368
           Q+ LKE  N
Sbjct: 513 QICLKEKEN 521


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 542 PPXPPXXPPPP 574
           PP P   PPPP
Sbjct: 338 PPKPAPPPPPP 348


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 209,125
Number of Sequences: 438
Number of extensions: 5125
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28766349
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)