BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP15_F_J06
(881 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 25 0.70
AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 22 8.6
>DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor
2 protein.
Length = 581
Score = 25.4 bits (53), Expect = 0.70
Identities = 12/30 (40%), Positives = 17/30 (56%)
Frame = +3
Query: 60 SIDTINMYNVFSIQFSSGALLCSGFVPEVH 149
S+ T Y +FS+ S LL SG PE++
Sbjct: 83 SMHTATNYYLFSLAVSDLLLLISGLPPEIY 112
>AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein.
Length = 355
Score = 21.8 bits (44), Expect = 8.6
Identities = 6/8 (75%), Positives = 7/8 (87%)
Frame = -3
Query: 177 CRWWPVGR 154
CR+WP GR
Sbjct: 200 CRFWPTGR 207
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 208,754
Number of Sequences: 438
Number of extensions: 4686
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28644972
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -