SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP15_F_I18
         (889 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    25   0.70 
AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    23   3.7  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 25.4 bits (53), Expect = 0.70
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 798 PPPPXPXPPPP 830
           PP P P PPPP
Sbjct: 338 PPKPAPPPPPP 348



 Score = 25.4 bits (53), Expect = 0.70
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +2

Query: 803 PPXPXPPPPXP 835
           PP P PPPP P
Sbjct: 338 PPKPAPPPPPP 348


>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 11/31 (35%), Positives = 14/31 (45%)
 Frame = +2

Query: 467 GIMCISYSRGRCELGGWIKKYVSQCIYVIYC 559
           G  C  Y  G  ++G +I   VSQ     YC
Sbjct: 372 GAECGKYPNGNTKVGSYIDWIVSQTPDAEYC 402


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 219,930
Number of Sequences: 438
Number of extensions: 6144
Number of successful extensions: 15
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28662543
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -