SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP15_F_F05
         (904 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-2801|AAF53581.1|  308|Drosophila melanogaster CG6012-PA...    29   6.6  

>AE014134-2801|AAF53581.1|  308|Drosophila melanogaster CG6012-PA
           protein.
          Length = 308

 Score = 29.5 bits (63), Expect = 6.6
 Identities = 11/44 (25%), Positives = 28/44 (63%)
 Frame = +3

Query: 150 INSKTEKLVLAAEVQSLKLASPKTIFKYNRKAKEPIVRSDALEV 281
           I  +T  + ++  V ++ +A+PK++ KYN++  + I+ ++ + V
Sbjct: 119 IEKETANIPISILVNNVGIATPKSLLKYNQEETQNIIDTNVVAV 162


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,323,161
Number of Sequences: 53049
Number of extensions: 501557
Number of successful extensions: 1346
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1271
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1338
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4403028645
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -