Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP14_F_H17
         (890 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1635 + 28286133-28286831                                         30   2.1  

>07_03_1635 + 28286133-28286831
          Length = 232

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 2/62 (3%)
 Frame = -1

Query: 218 FLEELPPGLGSSADRAREPAPTRRRSSKYVQ--NSFYRKFYSAGEFKIPNTISFDANAKN 45
           +L    P  G +A  +  P P R+RS  + Q      R   S GE   P+T ++DA  K 
Sbjct: 162 YLSPANPARGEAASASPSPPPRRKRSGDFGQWLGGAVRGMLS-GEAMSPDTAAYDAGYKT 220

Query: 44  QI 39
            I
Sbjct: 221 LI 222


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,948,369
Number of Sequences: 37544
Number of extensions: 263395
Number of successful extensions: 633
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 623
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 633
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2506954360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)