Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP14_F_E16
         (822 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       25   0.64 
DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    23   4.5  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   7.9  

>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 25.4 bits (53), Expect = 0.64
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = -1

Query: 348 KTARGTCLPAPVSLKKVLKESSPPPDVLVCGHLAIRLDAVLQAVKLPAG 202
           +++ G+ +P  ++L   L  S PPP+  V     + + A++ AV+ PAG
Sbjct: 360 ESSTGSSIPK-LNLSTALM-SQPPPNFGVSQVSPVSMSALVSAVRSPAG 406


>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 22.6 bits (46), Expect = 4.5
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -3

Query: 211 PSRHYRSGLR 182
           P RHYRSGL+
Sbjct: 139 PLRHYRSGLK 148


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 21.8 bits (44), Expect = 7.9
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +1

Query: 691  PPPPPXXPPXG 723
            PPPPP  P  G
Sbjct: 1355 PPPPPPPPSSG 1365


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 215,430
Number of Sequences: 438
Number of extensions: 5641
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26217432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)