Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP14_F_B24
         (1233 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_03_0458 + 14280953-14281866,14281964-14282912                       30   3.3  

>05_03_0458 + 14280953-14281866,14281964-14282912
          Length = 620

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 17/65 (26%), Positives = 24/65 (36%), Gaps = 1/65 (1%)
 Frame = +3

Query: 297 PXXXPSXXVXXXXHXXXPPGPXXXPSPXXNATPXXXTPQ-XTXXXCXAPPFXQXXXGXTT 473
           P   P   +    H   PP P    SP  ++ P   TP+  +   C AP   Q      +
Sbjct: 75  PPPLPPTTLSCSSHPTPPPPPSPTTSPSASSLPPVPTPRSASSSKCSAPTSAQTPTRFLS 134

Query: 474 TXPPP 488
           +  PP
Sbjct: 135 SSSPP 139


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,190,820
Number of Sequences: 37544
Number of extensions: 156222
Number of successful extensions: 260
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 194
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 254
length of database: 14,793,348
effective HSP length: 84
effective length of database: 11,639,652
effective search space used: 3794526552
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)