BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP13_F_C04
(889 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 24 2.1
DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 22 8.6
DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 22 8.6
DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 22 8.6
DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 22 8.6
DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 8.6
DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 8.6
DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 8.6
DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 8.6
>AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice
variant B protein.
Length = 810
Score = 23.8 bits (49), Expect = 2.1
Identities = 9/31 (29%), Positives = 15/31 (48%)
Frame = +1
Query: 511 ASQPAVWSXRNSVTXXQTSASXXNSVMIGDP 603
A +PA WS R + +T S ++ +P
Sbjct: 327 AGRPAFWSLRKAFARKKTDYSSFGKILATEP 357
>DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 21.8 bits (44), Expect = 8.6
Identities = 7/9 (77%), Positives = 8/9 (88%)
Frame = +2
Query: 506 HPPLNRRYG 532
HPPLN R+G
Sbjct: 163 HPPLNPRFG 171
>DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 21.8 bits (44), Expect = 8.6
Identities = 7/9 (77%), Positives = 8/9 (88%)
Frame = +2
Query: 506 HPPLNRRYG 532
HPPLN R+G
Sbjct: 163 HPPLNPRFG 171
>DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 21.8 bits (44), Expect = 8.6
Identities = 7/9 (77%), Positives = 8/9 (88%)
Frame = +2
Query: 506 HPPLNRRYG 532
HPPLN R+G
Sbjct: 163 HPPLNPRFG 171
>DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 21.8 bits (44), Expect = 8.6
Identities = 7/9 (77%), Positives = 8/9 (88%)
Frame = +2
Query: 506 HPPLNRRYG 532
HPPLN R+G
Sbjct: 163 HPPLNPRFG 171
>DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 21.8 bits (44), Expect = 8.6
Identities = 7/9 (77%), Positives = 8/9 (88%)
Frame = +2
Query: 506 HPPLNRRYG 532
HPPLN R+G
Sbjct: 167 HPPLNPRFG 175
>DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex
determiner protein.
Length = 184
Score = 21.8 bits (44), Expect = 8.6
Identities = 7/9 (77%), Positives = 8/9 (88%)
Frame = +2
Query: 506 HPPLNRRYG 532
HPPLN R+G
Sbjct: 172 HPPLNPRFG 180
>DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex
determiner protein.
Length = 184
Score = 21.8 bits (44), Expect = 8.6
Identities = 7/9 (77%), Positives = 8/9 (88%)
Frame = +2
Query: 506 HPPLNRRYG 532
HPPLN R+G
Sbjct: 172 HPPLNPRFG 180
>DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex
determiner protein.
Length = 184
Score = 21.8 bits (44), Expect = 8.6
Identities = 7/9 (77%), Positives = 8/9 (88%)
Frame = +2
Query: 506 HPPLNRRYG 532
HPPLN R+G
Sbjct: 172 HPPLNPRFG 180
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,555
Number of Sequences: 438
Number of extensions: 4784
Number of successful extensions: 11
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28662543
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -