Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP13_F_C04
         (889 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    24   2.1  
DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex det...    22   8.6  
DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex det...    22   8.6  
DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex det...    22   8.6  
DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex det...    22   8.6  
DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    22   8.6  
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    22   8.6  
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    22   8.6  
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    22   8.6  

>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 9/31 (29%), Positives = 15/31 (48%)
 Frame = +1

Query: 511 ASQPAVWSXRNSVTXXQTSASXXNSVMIGDP 603
           A +PA WS R +    +T  S    ++  +P
Sbjct: 327 AGRPAFWSLRKAFARKKTDYSSFGKILATEP 357


>DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 506 HPPLNRRYG 532
           HPPLN R+G
Sbjct: 163 HPPLNPRFG 171


>DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 506 HPPLNRRYG 532
           HPPLN R+G
Sbjct: 163 HPPLNPRFG 171


>DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 506 HPPLNRRYG 532
           HPPLN R+G
Sbjct: 163 HPPLNPRFG 171


>DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 506 HPPLNRRYG 532
           HPPLN R+G
Sbjct: 163 HPPLNPRFG 171


>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 506 HPPLNRRYG 532
           HPPLN R+G
Sbjct: 167 HPPLNPRFG 175


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 506 HPPLNRRYG 532
           HPPLN R+G
Sbjct: 172 HPPLNPRFG 180


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 506 HPPLNRRYG 532
           HPPLN R+G
Sbjct: 172 HPPLNPRFG 180


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 506 HPPLNRRYG 532
           HPPLN R+G
Sbjct: 172 HPPLNPRFG 180


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,555
Number of Sequences: 438
Number of extensions: 4784
Number of successful extensions: 11
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28662543
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)