Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP12_F_H19
         (843 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          23   4.7  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    22   8.1  

>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 22.6 bits (46), Expect = 4.7
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -1

Query: 555 YGSHRPPGSVDTP 517
           YG H  PG VD P
Sbjct: 281 YGHHPDPGEVDLP 293


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 9/32 (28%), Positives = 15/32 (46%)
 Frame = -2

Query: 398 YDRNHRGCRLCSDPRRPSDLSLKTDFFPTSVM 303
           ++ N      CSD +RP+  +      P S+M
Sbjct: 871 HENNQPTMNKCSDRKRPASQATSVKAEPGSIM 902


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,022
Number of Sequences: 438
Number of extensions: 3285
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27067071
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)