SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP11_F_J11
         (932 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_05_0225 - 23437454-23437793,23438348-23440573,23440771-23441603     28   9.2  

>05_05_0225 - 23437454-23437793,23438348-23440573,23440771-23441603
          Length = 1132

 Score = 28.3 bits (60), Expect = 9.2
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 2/67 (2%)
 Frame = +3

Query: 387 YANTMYIHDXSIXRTSVYA-SAVMPPXVXARGLRXXP-QCYEQNVPXXHMSXGXXXLRAY 560
           YANT++IH  +    SVY  S+V  P    + L   P  C   ++P      G   +   
Sbjct: 742 YANTLHIHSATSTSVSVYGWSSVSSPPALLQRLELLPCVCIFSSLPNWIGQLGNLCILMI 801

Query: 561 GLGSMXS 581
           G+  + S
Sbjct: 802 GIREVTS 808


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,671,413
Number of Sequences: 37544
Number of extensions: 101632
Number of successful extensions: 49
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 49
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2670960720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -