BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP11_F_J11
(932 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
05_05_0225 - 23437454-23437793,23438348-23440573,23440771-23441603 28 9.2
>05_05_0225 - 23437454-23437793,23438348-23440573,23440771-23441603
Length = 1132
Score = 28.3 bits (60), Expect = 9.2
Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 2/67 (2%)
Frame = +3
Query: 387 YANTMYIHDXSIXRTSVYA-SAVMPPXVXARGLRXXP-QCYEQNVPXXHMSXGXXXLRAY 560
YANT++IH + SVY S+V P + L P C ++P G +
Sbjct: 742 YANTLHIHSATSTSVSVYGWSSVSSPPALLQRLELLPCVCIFSSLPNWIGQLGNLCILMI 801
Query: 561 GLGSMXS 581
G+ + S
Sbjct: 802 GIREVTS 808
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,671,413
Number of Sequences: 37544
Number of extensions: 101632
Number of successful extensions: 49
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 49
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2670960720
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -