Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP10_F_P15
         (893 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating...    24   2.2  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    22   8.7  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    22   8.7  

>S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating
           peptide protein.
          Length = 50

 Score = 23.8 bits (49), Expect = 2.2
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = -3

Query: 285 VRILCFVFYFVW*TIFLLSSVFVTNHLQIAVRGTRVVADPH 163
           + +L   F+F+  ++ L++S FVT  + I     R V  PH
Sbjct: 2   ISMLRCTFFFL--SVILITSYFVTPTMSIKCNCKRHVIKPH 40


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 291 LFVRILCFVFYFV 253
           LF+ I+CFV Y +
Sbjct: 417 LFIAIVCFVSYLI 429


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 291 LFVRILCFVFYFV 253
           LF+ I+CFV Y +
Sbjct: 470 LFIAIVCFVSYLI 482


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 247,127
Number of Sequences: 438
Number of extensions: 5472
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28904421
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)