BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP10_F_J12
(905 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharo... 26 8.5
>SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6
|Schizosaccharomyces pombe|chr 1|||Manual
Length = 777
Score = 25.8 bits (54), Expect = 8.5
Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
Frame = -3
Query: 321 DLVHH-HEIFVGFHVCVAVLAGLDVEVLGDFVVLSFIVDLVNVVEKRQNLLLLF 163
DL HH + F GF VC+ ++ + + + D + L ++ +NVV N++ +F
Sbjct: 243 DLEHHDYRSFRGF-VCLMQISNREKDWIVDTLELREELEALNVVFTNPNIIKVF 295
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,426,028
Number of Sequences: 5004
Number of extensions: 68630
Number of successful extensions: 184
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 178
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 184
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 458501510
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -