BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP09_F_D12
(897 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q4MZX6 Cluster: Putative uncharacterized protein; n=1; ... 33 7.5
>UniRef50_Q4MZX6 Cluster: Putative uncharacterized protein; n=1;
Theileria parva|Rep: Putative uncharacterized protein -
Theileria parva
Length = 906
Score = 33.5 bits (73), Expect = 7.5
Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
Frame = -1
Query: 507 ICICSLSGYIKIKFNIDRFV*NVHFEIS*ITNTRFLIN-DIIQYIH-DYFIIKKLLKRFL 334
+C SL +K+K+ +D F N +EI + + R +IN D++ +I+ D L
Sbjct: 548 VCTKSLENRLKLKYGVDVFKNNYDYEIITVVDKREVINKDVVSHINIDIDTSNPNLMNKY 607
Query: 333 YTSRTREGKKQNE 295
Y T+ K+ N+
Sbjct: 608 YNKLTQYYKESNK 620
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 423,422,135
Number of Sequences: 1657284
Number of extensions: 5161172
Number of successful extensions: 8905
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8586
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8897
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 81161904978
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -