Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP08_F_O23
         (1438 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-963|AAF54394.4| 1173|Drosophila melanogaster CG9381-PC,...    31   5.1  

>AE014297-963|AAF54394.4| 1173|Drosophila melanogaster CG9381-PC,
            isoform C protein.
          Length = 1173

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 15/59 (25%), Positives = 22/59 (37%)
 Frame = +3

Query: 1065 NPNSTRXEXPSXLXQTKKTXPHXXXTNXKKHHXXTNSTQXKNXPTHTQKXQXLHRXTHH 1241
            N  + +   P+   QT  +       N K HH   NS    +  +H      LH+  HH
Sbjct: 119  NNVNNKDANPNCDVQTSNSSGTCIYNNSKAHHHHNNSNNNGHTQSHIHTNHSLHQGHHH 177


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.315    0.127    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,138,867
Number of Sequences: 53049
Number of extensions: 228817
Number of successful extensions: 414
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 340
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 411
length of database: 24,988,368
effective HSP length: 88
effective length of database: 20,320,056
effective search space used: 7924821840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)