BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP08_F_E17
(891 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 28 0.33
DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 2.3
>AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule
binding protein protein.
Length = 838
Score = 28.3 bits (60), Expect = 0.33
Identities = 16/64 (25%), Positives = 18/64 (28%)
Frame = +2
Query: 320 GGXXXGXXGKKNPPFPXKXXXXXXPKNXPXPXKXXXPPXKKKXXPPPXGXXXXXGXXXPP 499
GG G G PP P + P P P + PP G G P
Sbjct: 288 GGMPSGMVGPPRPPMPMQGGAPGGPPQGMRPNFYNRPMGDPQTSRPPSGNDNMGGGPPPS 347
Query: 500 XXPP 511
P
Sbjct: 348 SATP 351
>DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein.
Length = 889
Score = 25.4 bits (53), Expect = 2.3
Identities = 8/9 (88%), Positives = 8/9 (88%)
Frame = +3
Query: 489 GPPPPXPPG 515
GPPPP PPG
Sbjct: 529 GPPPPPPPG 537
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 412,664
Number of Sequences: 2352
Number of extensions: 5907
Number of successful extensions: 15
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 95920632
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -