SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP08_F_D15
         (863 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    24   2.1  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    23   4.8  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        23   4.8  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        23   4.8  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        23   4.8  

>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 9/39 (23%), Positives = 18/39 (46%)
 Frame = -2

Query: 256 GHSPGSVNSAPEAPYKEIQSRNNNIVKTSDWYERCRSNG 140
           GH  G+  S  + PY      N   ++ + +Y+  + +G
Sbjct: 63  GHHYGAAGSQQDMPYPRFPPYNRMDMRNATYYQHQQDHG 101


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 22.6 bits (46), Expect = 4.8
 Identities = 11/47 (23%), Positives = 19/47 (40%)
 Frame = -2

Query: 337 HRLHSLQRCTIHPENLV*SKFSCSFIFGHSPGSVNSAPEAPYKEIQS 197
           H  H+      H   L  S +  +   GH+P      PE P  ++++
Sbjct: 433 HHSHAATPHHQHSTPLAHSSYPAAIQIGHTPHHHPHPPETPGPQVET 479


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 4.8
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +1

Query: 319 ASYASDGRPIYDC 357
           A+Y+ D RP YDC
Sbjct: 405 AAYSRDVRPKYDC 417


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 4.8
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +1

Query: 319 ASYASDGRPIYDC 357
           A+Y+ D RP YDC
Sbjct: 405 AAYSRDVRPKYDC 417


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 4.8
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +1

Query: 319 ASYASDGRPIYDC 357
           A+Y+ D RP YDC
Sbjct: 405 AAYSRDVRPKYDC 417


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 241,121
Number of Sequences: 438
Number of extensions: 5229
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27916710
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -