BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP08_F_C05
(884 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 8.6
DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 8.6
DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 8.6
DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 8.6
DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 8.6
DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 8.6
DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 8.6
DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 8.6
AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 8.6
>DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 21.8 bits (44), Expect = 8.6
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = -1
Query: 563 PVFCDRIPSRP 531
P++C PSRP
Sbjct: 126 PIYCGNFPSRP 136
>DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 21.8 bits (44), Expect = 8.6
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = -1
Query: 563 PVFCDRIPSRP 531
P++C PSRP
Sbjct: 126 PIYCGNFPSRP 136
>DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 21.8 bits (44), Expect = 8.6
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = -1
Query: 563 PVFCDRIPSRP 531
P++C PSRP
Sbjct: 126 PIYCGNFPSRP 136
>DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 21.8 bits (44), Expect = 8.6
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = -1
Query: 563 PVFCDRIPSRP 531
P++C PSRP
Sbjct: 126 PIYCGNFPSRP 136
>DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 21.8 bits (44), Expect = 8.6
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = -1
Query: 563 PVFCDRIPSRP 531
P++C PSRP
Sbjct: 126 PIYCGNFPSRP 136
>DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 21.8 bits (44), Expect = 8.6
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = -1
Query: 563 PVFCDRIPSRP 531
P++C PSRP
Sbjct: 126 PIYCGNFPSRP 136
>DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 21.8 bits (44), Expect = 8.6
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = -1
Query: 563 PVFCDRIPSRP 531
P++C PSRP
Sbjct: 126 PIYCGNFPSRP 136
>DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex
determiner protein.
Length = 186
Score = 21.8 bits (44), Expect = 8.6
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = -1
Query: 563 PVFCDRIPSRP 531
P++C PSRP
Sbjct: 129 PIYCGNFPSRP 139
>AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice
variant B protein.
Length = 810
Score = 21.8 bits (44), Expect = 8.6
Identities = 9/31 (29%), Positives = 14/31 (45%)
Frame = +3
Query: 513 ASQPAVWSRRNSVTEDRTSASXQSSAMIGDP 605
A +PA WS R + +T S + +P
Sbjct: 327 AGRPAFWSLRKAFARKKTDYSSFGKILATEP 357
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,779
Number of Sequences: 438
Number of extensions: 3139
Number of successful extensions: 12
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28766349
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -