SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP07_F_P19
         (877 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          25   1.2  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   2.8  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   8.5  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       22   8.5  

>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 24.6 bits (51), Expect = 1.2
 Identities = 12/34 (35%), Positives = 13/34 (38%)
 Frame = +3

Query: 630 GXFFSHXXGGXVXXLPPPPXLXXPPXXLTTPPXA 731
           G  F H   G     P P  +  PP    TPP A
Sbjct: 270 GDMFCHTGLGHYGHHPDPGEVDLPPETQPTPPSA 303


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 573 PPSPXPPPP 599
           PP P PPPP
Sbjct: 338 PPKPAPPPP 346



 Score = 22.2 bits (45), Expect = 6.5
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 342 PXKXSPXPPPP 374
           P K +P PPPP
Sbjct: 338 PPKPAPPPPPP 348


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.8 bits (44), Expect = 8.5
 Identities = 9/15 (60%), Positives = 9/15 (60%)
 Frame = +3

Query: 342  PXKXSPXPPPPXGPP 386
            P   SP PPPP  PP
Sbjct: 1852 PVSGSPEPPPP--PP 1864


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.8 bits (44), Expect = 8.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 227 GNPPGAPP 250
           G PPGAPP
Sbjct: 49  GGPPGAPP 56


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,114
Number of Sequences: 438
Number of extensions: 3675
Number of successful extensions: 9
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28402218
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -