SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP07_F_J10
         (868 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0610 - 4415080-4415461,4415872-4416851                           29   6.4  
08_02_0864 + 21994286-21994989,21996257-21996958,21997221-219973...    28   8.4  

>06_01_0610 - 4415080-4415461,4415872-4416851
          Length = 453

 Score = 28.7 bits (61), Expect = 6.4
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = -2

Query: 489 WYVKYYXYNRGT 454
           WY+ YY YNRGT
Sbjct: 435 WYLSYYGYNRGT 446


>08_02_0864 + 21994286-21994989,21996257-21996958,21997221-21997374,
            21997494-21997838,21998323-21999240,21999312-21999640,
            21999709-21999832,21999901-22000071,22000188-22001648,
            22002647-22002910,22003866-22004189
          Length = 1831

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 3/61 (4%)
 Frame = -1

Query: 205  PPGLRSSADRAESQHQREDEAQNTYEIHFTEIL*C-RRIQNSNTI--SFDANAKNDQILR 35
            PP L  ++   E   Q  +E  ++ E+ FTE+L    +I     I  SFD N K  ++ R
Sbjct: 1073 PPKLDFTSQHQEWVEQEANEVVDSAELLFTEVLNALHQISEGRPITGSFDGNMKILELRR 1132

Query: 34   N 32
            N
Sbjct: 1133 N 1133


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,451,061
Number of Sequences: 37544
Number of extensions: 233164
Number of successful extensions: 442
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 434
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 442
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2432722788
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -