SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP07_F_I10
         (968 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   5.5  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   9.6  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    22   9.6  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 22.6 bits (46), Expect = 5.5
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +2

Query: 785 PXPQPXPPPP 814
           P P P PPPP
Sbjct: 339 PKPAPPPPPP 348


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 21.8 bits (44), Expect = 9.6
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 791  PQPXPPPPXXG 823
            P P PPPP  G
Sbjct: 1355 PPPPPPPPSSG 1365


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 21.8 bits (44), Expect = 9.6
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = +3

Query: 303 FQXNFIKNLKPAANHERPEEVIFXXXXYLPP 395
           F   FIKN+   +N    +++I     Y+PP
Sbjct: 306 FNFAFIKNVSRDSNSSDFKKLIDNWMTYMPP 336


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 214,881
Number of Sequences: 438
Number of extensions: 5466
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 31927896
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -