BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP06_F_P04
(891 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AC024859-18|AAK29974.1| 121|Caenorhabditis elegans Hypothetical... 77 2e-14
>AC024859-18|AAK29974.1| 121|Caenorhabditis elegans Hypothetical
protein Y71H2AM.5 protein.
Length = 121
Score = 76.6 bits (180), Expect = 2e-14
Identities = 28/66 (42%), Positives = 41/66 (62%)
Frame = -3
Query: 412 LKTAPFDPRFPNXNQTRHXYQSYVDFHRCQKVXGEKYEPXYYFKRVYRXXCPXEWVDKWD 233
L AP+D RFP + R + YVDFHRC ++ G+ Y+P +F+ VY+ CP W ++WD
Sbjct: 48 LWAAPYDARFPQVRKQRQCFAYYVDFHRCNELMGQDYKPCKFFQNVYKDFCPGFWTERWD 107
Query: 232 NQXAEG 215
+EG
Sbjct: 108 ELLSEG 113
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,592,813
Number of Sequences: 27780
Number of extensions: 252648
Number of successful extensions: 368
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 359
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 368
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2255353870
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -