SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP06_F_P03
         (885 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esteras...    23   4.2  
AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esteras...    23   4.2  
AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     22   7.4  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    22   7.4  
AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory recept...    22   7.4  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   9.7  

>AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 634 NFTNKAFFSLH 602
           NF NKAFF  H
Sbjct: 20  NFNNKAFFCFH 30


>AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 634 NFTNKAFFSLH 602
           NF NKAFF  H
Sbjct: 20  NFNNKAFFCFH 30


>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 2/31 (6%)
 Frame = +3

Query: 180 SGNGYEPIDNR--PYIVNPPKDYNPNGNGYE 266
           S +G++  D    P+IV  P++ NP+   Y+
Sbjct: 179 SHSGFQRSDGTFGPFIVRVPEEDNPHAKLYD 209


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 621 LFVKFVMLWLY 653
           LFV FV  WLY
Sbjct: 52  LFVSFVSYWLY 62


>AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory receptor
           candidate 3 protein.
          Length = 398

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 621 LFVKFVMLWLY 653
           LFV FV  WLY
Sbjct: 70  LFVSFVSYWLY 80


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = +1

Query: 232  PKTTTLMETATNLSTTVHITWTL 300
            P TT   +T T  STT   T T+
Sbjct: 1177 PSTTNHWQTKTTTSTTTRPTTTV 1199


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,899
Number of Sequences: 336
Number of extensions: 3485
Number of successful extensions: 11
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24513621
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -