SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP06_F_L12
         (1453 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350...    31   3.0  

>01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048,
            40535837-40535922,40536430-40536653,40536770-40536865,
            40538766-40538833,40539945-40540055,40540799-40540955
          Length = 545

 Score = 30.7 bits (66), Expect = 3.0
 Identities = 17/52 (32%), Positives = 19/52 (36%)
 Frame = +2

Query: 1196 DTAXGRPQRRXDXXPXXASAAAXEXPEXPXAPQSTAXXSXPTSXXXPRXTAP 1351
            D    RPQ      P  A       PE P  P+ST+    PTS   P    P
Sbjct: 409  DVYVSRPQSPPPPLPSDAFEQPPPPPEHPPPPESTSPPPPPTSDPPPVPPPP 460


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.313    0.138    0.456 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,490,308
Number of Sequences: 37544
Number of extensions: 222487
Number of successful extensions: 201
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 189
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 201
length of database: 14,793,348
effective HSP length: 85
effective length of database: 11,602,108
effective search space used: 4617638984
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)

- SilkBase 1999-2023 -