Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP06_F_G07
         (867 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    27   0.30 
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   2.8  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   2.8  
DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    22   6.4  
AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    22   8.4  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              22   8.4  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 26.6 bits (56), Expect = 0.30
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 844  PPPPPPPP 867
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 23.8 bits (49), Expect = 2.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 843  PPPPPPP 863
            PPPPPPP
Sbjct: 1355 PPPPPPP 1361



 Score = 23.8 bits (49), Expect = 2.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +2

Query: 842  PPPPPPP 862
            PPPPPPP
Sbjct: 1356 PPPPPPP 1362


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +1

Query: 844 PPPPPPPP 867
           P PPPPPP
Sbjct: 341 PAPPPPPP 348



 Score = 22.6 bits (46), Expect = 4.8
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +2

Query: 830 PXXXPPPPPP 859
           P   PPPPPP
Sbjct: 339 PKPAPPPPPP 348



 Score = 22.2 bits (45), Expect = 6.4
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 830 PXXXPPPPPPP 862
           P    PPPPPP
Sbjct: 338 PPKPAPPPPPP 348


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +1

Query: 844  PPPPPPPP 867
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864


>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 22.2 bits (45), Expect = 6.4
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +3

Query: 24  IGNSLRFLVDENDRLSVVRTAGGGLGRATVLPWLVTLAVSPL 149
           I  + R   D  DRL V+ T   G+G  T+     TL +  L
Sbjct: 127 ITTAYRIHADSCDRLWVLDTGTIGIGNTTIQACPYTLNIFDL 168


>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 13/39 (33%), Positives = 16/39 (41%)
 Frame = -2

Query: 266 TSTTAPSSCRPSVAFRWQGWTKANVCPTCFPERKXLKGS 150
           T    PS C  +      G T + +CPT  P    LK S
Sbjct: 357 TLERTPSKCSQTSVHYSNGQTHSQLCPT--PRSTHLKVS 393


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 272 WGTSTTAPSSCRP 234
           WG     PS+CRP
Sbjct: 512 WGILVYEPSACRP 524


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 247,529
Number of Sequences: 438
Number of extensions: 6794
Number of successful extensions: 40
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28038087
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)