SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP06_F_D06
         (1390 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    22   1.4  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    24   2.7  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 21.8 bits (44), Expect(2) = 1.4
 Identities = 12/52 (23%), Positives = 14/52 (26%)
 Frame = -3

Query: 410 PPPPPPPXXXXXGGXXVAXXXXXVXXRXLXXSXFXXXPLSAXPPXPXPGGXA 255
           PPPPPP                      +  S       +  PP P P   A
Sbjct: 343 PPPPPPSSSGPDSAKLDKIFDIATKENAMLLSGRSQKSTTGPPPGPTPAQKA 394



 Score = 21.4 bits (43), Expect(2) = 1.4
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 413 RPPPPPPP 390
           +P PPPPP
Sbjct: 340 KPAPPPPP 347


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 24.2 bits (50), Expect = 2.7
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = -3

Query: 413  RPPPPPPP 390
            +PPPPPPP
Sbjct: 1354 QPPPPPPP 1361



 Score = 23.8 bits (49), Expect = 3.6
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 410  PPPPPPP 390
            PPPPPPP
Sbjct: 1356 PPPPPPP 1362


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.315    0.140    0.449 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,524
Number of Sequences: 438
Number of extensions: 2969
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 60
effective length of database: 120,063
effective search space used: 48265326
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)

- SilkBase 1999-2023 -