BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP06_F_C08
(854 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 22 5.4
EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 9.4
>AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord
defective protein protein.
Length = 168
Score = 22.2 bits (45), Expect = 5.4
Identities = 12/40 (30%), Positives = 17/40 (42%)
Frame = +2
Query: 152 LQRDDAAALRGGGPRPDRATSCRGAVLVLVLEHEPALGGQ 271
L RD L GG PD + +++ H P + GQ
Sbjct: 124 LVRDGKPCLSGGPKHPDPGSLQVPGAPMMMSSHGPLMYGQ 163
>EF592537-1|ABQ95983.1| 593|Tribolium castaneum
beta-N-acetylglucosaminidase NAG2 protein.
Length = 593
Score = 21.4 bits (43), Expect = 9.4
Identities = 5/11 (45%), Positives = 7/11 (63%)
Frame = -3
Query: 435 KWCRRAGGRCW 403
+WC + G CW
Sbjct: 583 RWCYQNEGECW 593
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,097
Number of Sequences: 336
Number of extensions: 1943
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23659332
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -