SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP05_F_P19
         (1028 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    27   0.36 
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   3.4  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   3.4  
AB083209-1|BAC54133.1|   87|Apis mellifera hypothetical protein ...    22   7.8  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 26.6 bits (56), Expect = 0.36
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = -3

Query: 672  PPPPPPPP 649
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 21.0 bits (42), Expect(2) = 2.4
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +1

Query: 613  PPPPPP 630
            PPPPPP
Sbjct: 1355 PPPPPP 1360



 Score = 20.6 bits (41), Expect(2) = 2.4
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +1

Query: 727  PPXPPPP 747
            PP PPPP
Sbjct: 1356 PPPPPPP 1362


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.4 bits (48), Expect = 3.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 672 PPPPPPPP 649
           P PPPPPP
Sbjct: 341 PAPPPPPP 348


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.4 bits (48), Expect = 3.4
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 672  PPPPPPPP 649
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864



 Score = 22.2 bits (45), Expect = 7.8
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = -3

Query: 684  GXXXPPPPPP 655
            G   PPPPPP
Sbjct: 1855 GSPEPPPPPP 1864


>AB083209-1|BAC54133.1|   87|Apis mellifera hypothetical protein
           protein.
          Length = 87

 Score = 22.2 bits (45), Expect = 7.8
 Identities = 11/33 (33%), Positives = 12/33 (36%)
 Frame = +2

Query: 614 PPPPPXXXXXXXGGGGGGGGXXXPPPXPXFFFF 712
           PP PP       G   G  G    PP   F+ F
Sbjct: 52  PPGPPPNNEDSSGVIVGASGYGFVPPNQAFYRF 84


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 222,210
Number of Sequences: 438
Number of extensions: 7403
Number of successful extensions: 23
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 34346676
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -