Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP05_F_P08
         (920 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC11D3.08c |||amino acid permease, unknown 1|Schizosaccharomyc...    27   2.8  
SPCC569.06 |||S. pombe specific multicopy membrane protein famil...    27   3.7  

>SPAC11D3.08c |||amino acid permease, unknown 1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 550

 Score = 27.5 bits (58), Expect = 2.8
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = +2

Query: 32  GPFLXXFAHFRSWQXVAXXXFRXXKSFLWSLVWFWF 139
           GP +  F + +    V         + LWSLVW WF
Sbjct: 428 GPLMCRFVYNKFQPGVFYVGKWSKPAALWSLVWMWF 463


>SPCC569.06 |||S. pombe specific multicopy membrane protein family
           1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 478

 Score = 27.1 bits (57), Expect = 3.7
 Identities = 8/13 (61%), Positives = 12/13 (92%)
 Frame = +1

Query: 109 FSLVFGLVLVWWA 147
           FS+V+GL+ +WWA
Sbjct: 219 FSIVYGLISLWWA 231


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,938,749
Number of Sequences: 5004
Number of extensions: 34250
Number of successful extensions: 83
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 82
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 83
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 468512460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)