BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_M06 (900 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 25 0.94 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 5.0 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 22 8.8 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 22 8.8 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 22 8.8 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 22 8.8 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 8.8 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 8.8 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 8.8 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 8.8 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.0 bits (52), Expect = 0.94 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -2 Query: 716 RYRYTQKKKNENLNFLNIHSNKTYNVKLKDELYKNI*FI 600 R R + K +L+ IH+N YN +LY NI +I Sbjct: 295 RERSKEPKIISSLSNKTIHNNNNYNNYNNKKLYYNINYI 333 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.6 bits (46), Expect = 5.0 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -2 Query: 722 KIRYRYTQKKKNENLNFLNIHSNKTYNVKLKDELYKN 612 KI + K N N N ++N YN K YKN Sbjct: 313 KIISSLSNNYKYSNYNNYNNYNNNNYNNYNKKLYYKN 349 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 8.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 678 QIFVFFFLRIPVPNLQFRLLNEARFHHNVNAIFG 779 QI F ++ P P +F N RFH +N FG Sbjct: 138 QIPRFRYIGPPTPFPRFIPPNAYRFHPPLNPRFG 171 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 8.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 678 QIFVFFFLRIPVPNLQFRLLNEARFHHNVNAIFG 779 QI F ++ P P +F N RFH +N FG Sbjct: 138 QIPRFRYIGPPTPFPRFIPPNAYRFHPPLNPRFG 171 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 8.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 678 QIFVFFFLRIPVPNLQFRLLNEARFHHNVNAIFG 779 QI F ++ P P +F N RFH +N FG Sbjct: 138 QIPRFRYIGPPTPFPRFIPPNAYRFHPPLNPRFG 171 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 8.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 678 QIFVFFFLRIPVPNLQFRLLNEARFHHNVNAIFG 779 QI F ++ P P +F N RFH +N FG Sbjct: 138 QIPRFRYIGPPTPFPRFIPPNAYRFHPPLNPRFG 171 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 8.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 678 QIFVFFFLRIPVPNLQFRLLNEARFHHNVNAIFG 779 QI F ++ P P +F N RFH +N FG Sbjct: 142 QIPRFRYIGPPTPFPRFIPPNAYRFHPPLNPRFG 175 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 8.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 678 QIFVFFFLRIPVPNLQFRLLNEARFHHNVNAIFG 779 QI F ++ P P +F N RFH +N FG Sbjct: 147 QIPRFRYIGPPTPFPRFIPPNAYRFHPPLNPRFG 180 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 8.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 678 QIFVFFFLRIPVPNLQFRLLNEARFHHNVNAIFG 779 QI F ++ P P +F N RFH +N FG Sbjct: 147 QIPRFRYIGPPTPFPRFIPPNAYRFHPPLNPRFG 180 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 8.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 678 QIFVFFFLRIPVPNLQFRLLNEARFHHNVNAIFG 779 QI F ++ P P +F N RFH +N FG Sbjct: 147 QIPRFRYIGPPTPFPRFIPPNAYRFHPPLNPRFG 180 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,123 Number of Sequences: 438 Number of extensions: 4223 Number of successful extensions: 21 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29146299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -