BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_L24 (933 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF137396-7|AAG41681.1| 326|Homo sapiens HOR5'Beta7 protein. 32 3.4 AK126810-1|BAC86703.1| 195|Homo sapiens protein ( Homo sapiens ... 31 7.9 >AF137396-7|AAG41681.1| 326|Homo sapiens HOR5'Beta7 protein. Length = 326 Score = 31.9 bits (69), Expect = 3.4 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 658 LLVRSPVPTLPLTGYLSAFLPSGSVALSHS 747 ++ R PV T+P+ L AF GSV LSHS Sbjct: 160 VIFRGPVATIPIVLLLKAFPYCGSVVLSHS 189 >AK126810-1|BAC86703.1| 195|Homo sapiens protein ( Homo sapiens cDNA FLJ44860 fis, clone BRALZ2007661. ). Length = 195 Score = 30.7 bits (66), Expect = 7.9 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 650 PGSSSCALLFRPCRLPDTCPPFSLREAWRFLI 745 PG SC L +P R P CP S AW L+ Sbjct: 9 PGRKSCTLGLQPHRGPSVCPRASPLRAWPALL 40 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,590,399 Number of Sequences: 237096 Number of extensions: 2825478 Number of successful extensions: 11998 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11998 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12214492840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -