BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_L07 (1092 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 49 2e-04 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 48 4e-04 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 46 0.001 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 45 0.003 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 45 0.004 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 45 0.004 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 45 0.004 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 44 0.007 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 44 0.009 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 43 0.016 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 42 0.021 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 42 0.021 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 42 0.021 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 42 0.021 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 42 0.021 UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n... 42 0.028 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 42 0.028 UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to... 42 0.037 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 42 0.037 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 42 0.037 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 42 0.037 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 42 0.037 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 42 0.037 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 41 0.049 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 41 0.049 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 41 0.049 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 41 0.049 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 41 0.064 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 41 0.064 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 41 0.064 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 41 0.064 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 41 0.064 UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella ve... 41 0.064 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 41 0.064 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 41 0.064 UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Pr... 41 0.064 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 41 0.064 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 40 0.085 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 40 0.11 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 40 0.11 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 40 0.11 UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pomb... 40 0.11 UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; ... 40 0.15 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 40 0.15 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 39 0.20 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 39 0.20 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 39 0.20 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 39 0.20 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 39 0.20 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 39 0.20 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 39 0.20 UniRef50_Q9GYL4 Cluster: Putative uncharacterized protein R04E5.... 39 0.20 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 39 0.20 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 39 0.20 UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, wh... 39 0.20 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 39 0.20 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 39 0.20 UniRef50_Q5CHL3 Cluster: Hydroxyproline-rich glycoprotein dz-hrg... 32 0.21 UniRef50_Q6ML35 Cluster: Putative uncharacterized protein; n=1; ... 39 0.26 UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|R... 39 0.26 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 39 0.26 UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; D... 39 0.26 UniRef50_A2F9Y4 Cluster: Putative uncharacterized protein; n=1; ... 39 0.26 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 39 0.26 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 38 0.34 UniRef50_A4LPA5 Cluster: Intracellular motility protein A; n=6; ... 38 0.34 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 38 0.34 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 38 0.34 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 38 0.34 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 38 0.34 UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; ... 38 0.34 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 38 0.34 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 38 0.34 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 38 0.34 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 38 0.34 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 38 0.34 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 38 0.34 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 38 0.34 UniRef50_UPI0000F2E28C Cluster: PREDICTED: similar to high-mobil... 38 0.45 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 38 0.45 UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 ... 38 0.45 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 38 0.45 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 38 0.45 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 38 0.45 UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; ... 38 0.45 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 38 0.45 UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic p... 32 0.51 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 38 0.60 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 38 0.60 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 38 0.60 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 38 0.60 UniRef50_A1SEF2 Cluster: Putative uncharacterized protein; n=1; ... 38 0.60 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 38 0.60 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 38 0.60 UniRef50_Q9FLQ6 Cluster: Similarity to unknown protein; n=2; Ara... 38 0.60 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 38 0.60 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 38 0.60 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 38 0.60 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 38 0.60 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 38 0.60 UniRef50_O48682 Cluster: F3I6.8 protein; n=2; Arabidopsis thalia... 38 0.60 UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; ... 38 0.60 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 38 0.60 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 38 0.60 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 38 0.60 UniRef50_A6QT05 Cluster: Predicted protein; n=1; Ajellomyces cap... 38 0.60 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 38 0.60 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 38 0.60 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 38 0.60 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 38 0.60 UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous... 37 0.79 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 37 0.79 UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar ... 37 0.79 UniRef50_Q9N3F7 Cluster: Putative uncharacterized protein; n=2; ... 37 0.79 UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Dia... 37 0.79 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 37 0.79 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 37 0.79 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 37 0.79 UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium glob... 37 0.79 UniRef50_A0JLT2 Cluster: Mediator of RNA polymerase II transcrip... 37 0.79 UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5... 37 0.79 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 37 0.79 UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Eut... 37 0.79 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 37 1.0 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 37 1.0 UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein... 37 1.0 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 37 1.0 UniRef50_Q6P120 Cluster: Enah/Vasp-like b; n=2; Danio rerio|Rep:... 37 1.0 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 37 1.0 UniRef50_Q4RLP1 Cluster: Chromosome 10 SCAF15019, whole genome s... 37 1.0 UniRef50_Q4KT78 Cluster: ORF1629; n=2; Nucleopolyhedrovirus|Rep:... 37 1.0 UniRef50_Q9FF14 Cluster: Similarity to unknown protein; n=3; Ara... 37 1.0 UniRef50_Q6H899 Cluster: Nuclear protein ZAP-like; n=6; Magnolio... 37 1.0 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 37 1.0 UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23... 37 1.0 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 37 1.0 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 37 1.0 UniRef50_Q54BJ4 Cluster: Putative uncharacterized protein; n=1; ... 37 1.0 UniRef50_A2DXB4 Cluster: Formin Homology 2 Domain containing pro... 37 1.0 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 37 1.0 UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cere... 37 1.0 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 37 1.0 UniRef50_Q0UMH1 Cluster: Putative uncharacterized protein; n=1; ... 37 1.0 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 37 1.0 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 36 1.4 UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|R... 36 1.4 UniRef50_A0QHS8 Cluster: Putative uncharacterized protein; n=2; ... 36 1.4 UniRef50_A5BPY4 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG068... 36 1.4 UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG214... 36 1.4 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 36 1.4 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_Q23248 Cluster: Putative uncharacterized protein grl-21... 36 1.4 UniRef50_Q19479 Cluster: Putative uncharacterized protein inft-2... 36 1.4 UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.4 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 36 1.4 UniRef50_Q5AAF4 Cluster: Putative uncharacterized protein BNI1; ... 36 1.4 UniRef50_Q2H3D5 Cluster: Putative uncharacterized protein; n=3; ... 36 1.4 UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 36 1.4 UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogene... 36 1.8 UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein;... 36 1.8 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 36 1.8 UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, in... 36 1.8 UniRef50_UPI00006A1088 Cluster: WAS/WASL interacting protein fam... 36 1.8 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 36 1.8 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 36 1.8 UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; ce... 36 1.8 UniRef50_Q7F0U2 Cluster: OJ1116_C07.3 protein; n=4; Oryza sativa... 36 1.8 UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12;... 36 1.8 UniRef50_Q5DGR5 Cluster: SJCHGC08168 protein; n=1; Schistosoma j... 36 1.8 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.8 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 36 1.8 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 36 1.8 UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 36 1.8 UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; ... 36 1.8 UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; ... 36 1.8 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 36 1.8 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 36 1.8 UniRef50_UPI00015B55AC Cluster: PREDICTED: similar to GA10757-PA... 36 2.4 UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH30... 36 2.4 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 36 2.4 UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae... 36 2.4 UniRef50_Q0DB93 Cluster: Os06g0590100 protein; n=11; Oryza sativ... 36 2.4 UniRef50_A4RZ69 Cluster: Predicted protein; n=2; Ostreococcus|Re... 36 2.4 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 36 2.4 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 36 2.4 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 36 2.4 UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleosto... 36 2.4 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 36 2.4 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 36 2.4 UniRef50_UPI000023F6A5 Cluster: hypothetical protein FG10389.1; ... 35 3.2 UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whol... 35 3.2 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 35 3.2 UniRef50_O86637 Cluster: Putative uncharacterized protein SCO571... 35 3.2 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 35 3.2 UniRef50_A5V8M1 Cluster: OmpA/MotB domain protein precursor; n=3... 35 3.2 UniRef50_Q6F2W0 Cluster: Putative Dof zinc finger protein; n=2; ... 35 3.2 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 35 3.2 UniRef50_Q2RAC3 Cluster: Harpin-induced protein 1 containing pro... 35 3.2 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 35 3.2 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 35 3.2 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 35 3.2 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 35 3.2 UniRef50_A3BQ84 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|R... 35 3.2 UniRef50_Q54CQ8 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|... 35 3.2 UniRef50_Q6FIZ5 Cluster: Similarity; n=1; Candida glabrata|Rep: ... 35 3.2 UniRef50_Q5ANI0 Cluster: Potential fungal zinc cluster transcrip... 35 3.2 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 35 3.2 UniRef50_Q0UAV3 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 35 3.2 UniRef50_Q9LS95 Cluster: Somatic embryogenesis receptor kinase-l... 32 3.6 UniRef50_Q2GSB8 Cluster: Predicted protein; n=1; Chaetomium glob... 33 3.9 UniRef50_UPI00015B5CAE Cluster: PREDICTED: similar to conserved ... 35 4.2 UniRef50_UPI00006A1328 Cluster: C219-reactive peptide; n=4; Tetr... 35 4.2 UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n... 35 4.2 UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; ... 35 4.2 UniRef50_Q684D7 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 35 4.2 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 35 4.2 UniRef50_A0W7U9 Cluster: Putative uncharacterized protein precur... 35 4.2 UniRef50_A0PNV4 Cluster: Sensor protein; n=3; Mycobacterium|Rep:... 35 4.2 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 35 4.2 UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza s... 35 4.2 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 35 4.2 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 35 4.2 UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - ... 35 4.2 UniRef50_Q93107 Cluster: Myosin I heavy chain kinase; n=1; Acant... 35 4.2 UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms... 35 4.2 UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 35 4.2 UniRef50_Q1HMI9 Cluster: Formin C; n=3; Trypanosoma cruzi|Rep: F... 35 4.2 UniRef50_Q00486 Cluster: Mini-collagen precursor; n=2; Hydra sp.... 35 4.2 UniRef50_A0CRC9 Cluster: Chromosome undetermined scaffold_25, wh... 35 4.2 UniRef50_Q2H9M3 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q2H982 Cluster: Predicted protein; n=1; Chaetomium glob... 35 4.2 UniRef50_A6RUF2 Cluster: Putative uncharacterized protein; n=2; ... 35 4.2 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 35 4.2 UniRef50_Q8TF74 Cluster: WAS/WASL-interacting protein family mem... 35 4.2 UniRef50_A7TK46 Cluster: Putative uncharacterized protein; n=1; ... 27 4.6 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 34 5.6 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 34 5.6 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 34 5.6 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 34 5.6 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 34 5.6 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 34 5.6 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 34 5.6 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 34 5.6 UniRef50_A3ZWA6 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 34 5.6 UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|R... 34 5.6 UniRef50_Q4PSF3 Cluster: Proline-rich extensin-like family prote... 34 5.6 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 34 5.6 UniRef50_Q01A68 Cluster: Chromosome 04 contig 1, DNA sequence; n... 34 5.6 UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreoco... 34 5.6 UniRef50_Q00S27 Cluster: Chromosome 19 contig 1, DNA sequence; n... 34 5.6 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 34 5.6 UniRef50_Q86BM9 Cluster: CG33003-PA; n=1; Drosophila melanogaste... 34 5.6 UniRef50_Q7PUM7 Cluster: ENSANGP00000017379; n=4; Coelomata|Rep:... 34 5.6 UniRef50_Q54TI7 Cluster: WH2 domain-containing protein; n=1; Dic... 34 5.6 UniRef50_A0EAP8 Cluster: Chromosome undetermined scaffold_86, wh... 34 5.6 UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|... 34 5.6 UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere... 34 5.6 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_A5DP36 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 34 5.6 UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Ad... 34 5.6 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 34 5.6 UniRef50_Q99954 Cluster: Submaxillary gland androgen-regulated p... 34 5.6 UniRef50_P05143 Cluster: Proline-rich protein 2 precursor; n=10;... 34 5.6 UniRef50_Q9NSV4 Cluster: Protein diaphanous homolog 3; n=66; Deu... 34 5.6 UniRef50_UPI0000F2C731 Cluster: PREDICTED: hypothetical protein;... 34 7.4 UniRef50_UPI0000E45FF5 Cluster: PREDICTED: hypothetical protein;... 34 7.4 UniRef50_UPI0000584992 Cluster: PREDICTED: similar to actin bind... 34 7.4 UniRef50_UPI0000DC2237 Cluster: RIKEN cDNA D030022P06 gene; n=6;... 34 7.4 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 34 7.4 UniRef50_Q4SS96 Cluster: Chromosome 11 SCAF14479, whole genome s... 34 7.4 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 34 7.4 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 34 7.4 UniRef50_Q117D5 Cluster: Putative uncharacterized protein precur... 34 7.4 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 34 7.4 UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein p... 34 7.4 UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabido... 34 7.4 UniRef50_A7Q9D7 Cluster: Chromosome chr19 scaffold_66, whole gen... 34 7.4 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 34 7.4 UniRef50_Q8IRB3 Cluster: CG32241-PA; n=1; Drosophila melanogaste... 34 7.4 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 34 7.4 UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; ... 34 7.4 UniRef50_A7RMK5 Cluster: Predicted protein; n=1; Nematostella ve... 34 7.4 UniRef50_A0NCF4 Cluster: ENSANGP00000030385; n=2; Eukaryota|Rep:... 34 7.4 UniRef50_A0DM29 Cluster: Chromosome undetermined scaffold_56, wh... 34 7.4 UniRef50_Q5KN38 Cluster: Putative uncharacterized protein; n=1; ... 34 7.4 UniRef50_Q2H6A2 Cluster: Putative uncharacterized protein; n=4; ... 34 7.4 UniRef50_Q2H239 Cluster: Putative uncharacterized protein; n=1; ... 34 7.4 UniRef50_A7F7G2 Cluster: Putative uncharacterized protein; n=2; ... 34 7.4 UniRef50_A4R9P2 Cluster: Predicted protein; n=1; Magnaporthe gri... 34 7.4 UniRef50_Q8ZSX8 Cluster: Putative uncharacterized protein PAE353... 34 7.4 UniRef50_P10323 Cluster: Acrosin precursor (EC 3.4.21.10) [Conta... 34 7.4 UniRef50_Q7Z5R6 Cluster: Amyloid beta A4 precursor protein-bindi... 34 7.4 UniRef50_Q9U299 Cluster: 5'-3' exoribonuclease 2 homolog; n=7; B... 27 7.8 UniRef50_UPI00015056F9 Cluster: DNA binding / ligand-dependent n... 33 9.8 UniRef50_UPI0000F2E662 Cluster: PREDICTED: similar to CBLL1 prot... 33 9.8 UniRef50_UPI0000EBEBA8 Cluster: PREDICTED: hypothetical protein;... 33 9.8 UniRef50_UPI0000DB7124 Cluster: PREDICTED: similar to CG32030-PA... 33 9.8 UniRef50_UPI0000DB6BDB Cluster: PREDICTED: similar to prickle CG... 33 9.8 UniRef50_UPI0000519E67 Cluster: PREDICTED: similar to expanded C... 33 9.8 UniRef50_UPI0000498407 Cluster: hypothetical protein 13.t00006; ... 33 9.8 UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; ... 33 9.8 UniRef50_Q1HH11 Cluster: Desmoplakin; n=1; Antheraea pernyi nucl... 33 9.8 UniRef50_Q1NB62 Cluster: OmpA/MotB; n=1; Sphingomonas sp. SKA58|... 33 9.8 UniRef50_A4TTL3 Cluster: Putative uncharacterized protein; n=2; ... 33 9.8 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 33 9.8 UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En... 33 9.8 UniRef50_Q0D5P3 Cluster: Os07g0545500 protein; n=4; Magnoliophyt... 33 9.8 UniRef50_O49946 Cluster: Extensin-like protein; n=5; Solanaceae|... 33 9.8 UniRef50_O04532 Cluster: F20P5.14 protein; n=1; Arabidopsis thal... 33 9.8 UniRef50_A4RW22 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 9.8 UniRef50_A2Q4Q2 Cluster: Phosphoinositide-binding clathrin adapt... 33 9.8 UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG057... 33 9.8 UniRef50_Q54CK9 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 33 9.8 UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella ve... 33 9.8 UniRef50_A2EVR8 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_A2DNB1 Cluster: Putative uncharacterized protein; n=2; ... 33 9.8 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 33 9.8 UniRef50_Q6BI43 Cluster: Similar to CA6126|IPF143 Candida albica... 33 9.8 UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_Q2HGM6 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 33 9.8 UniRef50_A1CQS9 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family... 33 9.8 UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - ... 33 9.8 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 33 9.8 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = -2 Query: 878 FFFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 +F PPPP GG PPPPPPG P PPP P Sbjct: 412 YFSGPPPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPP 449 Score = 47.2 bits (107), Expect = 7e-04 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPPG P PPP P Sbjct: 430 PPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPP 463 Score = 44.8 bits (101), Expect = 0.004 Identities = 27/78 (34%), Positives = 29/78 (37%), Gaps = 2/78 (2%) Frame = -1 Query: 879 IFFFSPPPXXXGGXGXXXP--PPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGX 706 +F+FS PP G P PPPPP PP PPP GGG Sbjct: 410 LFYFSGPPPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGG- 468 Query: 705 XXXXXKKXPXPPPPXXGG 652 P PPPP GG Sbjct: 469 -------PPPPPPPPGGG 479 Score = 44.8 bits (101), Expect = 0.004 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPPG P PPP Sbjct: 444 PPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPP 475 Score = 41.9 bits (94), Expect = 0.028 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -2 Query: 878 FFFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 F+F PPP G PPPPPP P PPP P Sbjct: 411 FYFSGPPPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPP 448 Score = 40.3 bits (90), Expect = 0.085 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 429 PPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPP 462 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 457 PPPPPPPGPGGGPPPPPPPPGGG---PPGPPPPP 487 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 455 PPPPPPPPPGPGGGPPPPPPPPGGGPPGPPPP 486 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPP PP PPP Sbjct: 455 PPPPPPPPPGPGGGPPPPPPPPGGGPPGPPPP 486 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 48.0 bits (109), Expect = 4e-04 Identities = 25/71 (35%), Positives = 26/71 (36%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G G PPPPPP PP PPP + GG Sbjct: 971 PPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGA-------P 1023 Query: 684 XPXPPPPXXGG 652 P PPPP GG Sbjct: 1024 PPPPPPPMHGG 1034 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 958 PPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPP 989 Score = 40.3 bits (90), Expect = 0.085 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 969 PPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPP 1002 Score = 39.9 bits (89), Expect = 0.11 Identities = 24/71 (33%), Positives = 25/71 (35%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G PPPPPP PP PPP + GG Sbjct: 1011 PPPPPPPMHGGAPPPPPPPPMHGGAPP-PPPPPPMHGGAPPPPPPPPMHGGA-------- 1061 Query: 684 XPXPPPPXXGG 652 P PPPP GG Sbjct: 1062 PPPPPPPMFGG 1072 Score = 39.5 bits (88), Expect = 0.15 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 1012 PPPPPPMHGGAP--PPPPPPPMHGGAPPPPPPPP 1043 Score = 39.5 bits (88), Expect = 0.15 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 1025 PPPPPPMHGGAP--PPPPPPPMHGGAPPPPPPPP 1056 Score = 39.5 bits (88), Expect = 0.15 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 +PPP G PPPPPP PP PP Sbjct: 1061 APPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGG 1120 Query: 687 KXPXPPPPXXGG 652 P PPPP GG Sbjct: 1121 APPPPPPPMRGG 1132 Score = 39.5 bits (88), Expect = 0.15 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 1135 PPPPPPGGRGPGAPPPPPPPGGRAPGP-PPPPGP 1167 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 945 PPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPP 976 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 958 PPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPP 989 Score = 39.1 bits (87), Expect = 0.20 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G PPPPPP PP PP Sbjct: 1050 PPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGA 1109 Query: 684 XPXPPPPXXGG 652 P PPPP GG Sbjct: 1110 PPPPPPPMHGG 1120 Score = 38.7 bits (86), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 945 PPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPP 976 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 944 PPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPP 977 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 957 PPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPP 990 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 943 PPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPP 976 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 956 PPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPP 989 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 1011 PPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPP 1042 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 1024 PPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPP 1055 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 1037 PPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPP 1068 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP G P PPP Sbjct: 1122 PPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPP 1153 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 997 PPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPP 1030 Score = 37.5 bits (83), Expect = 0.60 Identities = 23/74 (31%), Positives = 24/74 (32%), Gaps = 3/74 (4%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP GG PPPPPP P PPP G + Sbjct: 1027 PPPPMHGGA----PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMR 1082 Query: 684 ---XPXPPPPXXGG 652 P PPPP GG Sbjct: 1083 GGAPPPPPPPMRGG 1096 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPP P PPP Sbjct: 1051 PPPPPPMHGGAP--PPPPPPMFGGAQPPPPPP 1080 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP G P P P P Sbjct: 1136 PPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRP 1169 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP G PPPPPP PP PPP Sbjct: 934 SPPPPSYGSP---PPPPPPPPSYGSPPPPPPPP 963 Score = 35.9 bits (79), Expect = 1.8 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 +PPP G PPPPPP P PPP GGG Sbjct: 1121 APPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPGGG------- 1173 Query: 687 KXPXPPPPXXG 655 PPPP G Sbjct: 1174 ---PPPPPMLG 1181 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 +PPP G PPPPPP PP PP Sbjct: 1109 APPPPPPPMHGGAPPPPPPPMRGGAPPPPPPP 1140 Score = 35.1 bits (77), Expect = 3.2 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP GG PPPPPP PP PPP + Sbjct: 1077 PPPPMRGGA---PPPPPPPMRGGAPPP--PPPPMRGGAPPPPPPPMHGGAPPPPPPPMRG 1131 Query: 684 XPXPPPPXXGG 652 PPPP GG Sbjct: 1132 GAPPPPPPPGG 1142 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP P PPP Sbjct: 942 SPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPP 974 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP P PPP Sbjct: 955 SPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPP 987 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/71 (35%), Positives = 26/71 (36%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP GG PPPPP PP PPP + GGG Sbjct: 654 PPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGG-------- 705 Query: 684 XPXPPPPXXGG 652 P PPPP GG Sbjct: 706 PPPPPPPPGGG 716 Score = 43.6 bits (98), Expect = 0.009 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 652 PPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPP 685 Score = 43.6 bits (98), Expect = 0.009 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 666 PPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPP 699 Score = 43.6 bits (98), Expect = 0.009 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 667 PPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPP 700 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPP P PPP Sbjct: 681 PPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPP 712 Score = 40.3 bits (90), Expect = 0.085 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP PPP P Sbjct: 651 PPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPP 684 Score = 40.3 bits (90), Expect = 0.085 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 680 PPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPP 713 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 694 PPPPPPPMTGGGPPPPPPPPGGG---PPPPPPPP 724 Score = 38.7 bits (86), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPP P PPP Sbjct: 706 PPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPP 737 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 706 PPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPP 737 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP P PPP P Sbjct: 653 PPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPP 686 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 650 PPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPP 683 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 665 PPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPP 698 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG PPPPPP PP PPP Sbjct: 697 PPPPMTGGG----PPPPPPPPGGGPPPPPPPP 724 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 717 PPPPPPPPGAKAGGPPPPPPPFGKGPP--PPP 746 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 45.2 bits (102), Expect = 0.003 Identities = 24/73 (32%), Positives = 24/73 (32%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G G PPPPPP PP PPP Sbjct: 351 PPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNAS------MA 404 Query: 684 XPXPPPPXXGGXF 646 P PPPP GG F Sbjct: 405 PPPPPPPPLGGKF 417 Score = 43.6 bits (98), Expect = 0.009 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 337 PPPPRPGNMGVPPPPPPPPPGNMGVPPPPPPPPP 370 Score = 43.2 bits (97), Expect = 0.012 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPPG PPP P Sbjct: 281 PPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPP 314 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 351 PPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPP 382 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG P PPP P Sbjct: 309 PPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRP 342 Score = 39.1 bits (87), Expect = 0.20 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 323 PPPPPPGNMGVLPPPPPPRPGNMGVPPPPPPPPP 356 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPPG P PPP Sbjct: 296 PPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPP 327 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 295 PPPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPPP 328 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 350 PPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPP 383 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPP P PPP P Sbjct: 379 PPPPPGYTGSSLPPPAPPPPQNASMAPPPPPPPP 412 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 349 PPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPP 382 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 362 PPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAP 395 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 348 PPPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPP 381 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 393 PAPPPPQNASMAPPPPPPPPLGGKFLPPPPPPPP 426 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G PPPPPP P PPP Sbjct: 308 APPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPP 340 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPP 771 PPPP G PPPPPP G P PPP Sbjct: 363 PPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPP 398 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPP G P PPP P Sbjct: 395 PPPPQNASMAPPPPPPPPLGGKFLPPPPPPPPP 427 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 44.8 bits (101), Expect = 0.004 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPPG P PPP Sbjct: 758 PPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPP 789 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 744 PPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPP 777 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG PPPPPP PP PPP Sbjct: 760 PPPPPPGGC-PPPPPPPPPGGFKGGPPPPPPP 790 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP G P PPP Sbjct: 759 PPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPP 790 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG PPP P Sbjct: 713 PPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPP 746 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG PPP P Sbjct: 729 PPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPP 762 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -1 Query: 864 PPPXXXGGXG--XXXPPPPPPXXXXXXPPXXPPP 769 PPP GG PPPPPP PP PPP Sbjct: 743 PPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPP 776 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP P PPP Sbjct: 758 PPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPP 789 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 44.8 bits (101), Expect = 0.004 Identities = 24/70 (34%), Positives = 25/70 (35%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP GG G PPPPPP P PPP GG + Sbjct: 844 PPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGG------PR 897 Query: 684 XPXPPPPXXG 655 P PPPP G Sbjct: 898 PPGPPPPPGG 907 Score = 44.8 bits (101), Expect = 0.004 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 845 PPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPP 878 Score = 42.3 bits (95), Expect = 0.021 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG P PPP P Sbjct: 830 PPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPP 863 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 844 PPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPP 877 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG PPP P Sbjct: 860 PPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPP 893 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G + PPPPPP PPP P Sbjct: 826 PPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPP 859 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G + PPPPPP PPP P Sbjct: 841 PPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPP 874 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP P PPP P Sbjct: 872 PPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPP 905 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP G P PPP P Sbjct: 831 PPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPP 864 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 872 FFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 F PPPP PPPPPPG P PPP P Sbjct: 804 FVPPPP----------PPPPPPGGSKTLPRPPPPPP 829 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP---PPPPPGXXXXXPXXPPPXP 765 PPPP GG + P PPPPP PPP P Sbjct: 808 PPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPP 844 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 846 PPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPP 879 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP GG PPPPPG P P P Sbjct: 887 PPPPPPPGGPRPPGPPPPPGGAPPLPPGPRP 917 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = -2 Query: 875 FFFPPPPXXXXGGXE--------XXPPPPPPGXXXXXPXXPPPXP 765 F PPPP G PPPPPPG P PPP P Sbjct: 804 FVPPPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPP 848 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP G P PP Sbjct: 887 PPPPPPPGGPRPPGPPPPPGGAPPLPPGPRPP 918 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 44.8 bits (101), Expect = 0.004 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPPG P PPP Sbjct: 1058 PPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPP 1089 Score = 44.8 bits (101), Expect = 0.004 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG G PPPPPP PP PPP Sbjct: 1072 PPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPP 1103 Score = 43.6 bits (98), Expect = 0.009 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 1070 PPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPP 1103 Score = 43.2 bits (97), Expect = 0.012 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 1071 PPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPP 1104 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG G PPPPPP P PPP Sbjct: 1057 PPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPP 1088 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 1085 PPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPP 1116 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG G PPPPPP P PPP Sbjct: 1085 PPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPP 1116 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPP G P PPP Sbjct: 1086 PPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPP 1117 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 1086 PPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPP 1117 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 1058 PPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPP 1089 Score = 39.9 bits (89), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP PPP P Sbjct: 1055 PPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPP 1088 Score = 39.9 bits (89), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP PPP P Sbjct: 1083 PPPPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPP 1116 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP---PPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPPG P PPP P Sbjct: 1040 PPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPP 1076 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXG--GXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G G PPPPPP PPP P Sbjct: 1020 PPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPP 1055 Score = 33.9 bits (74), Expect = 7.4 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 5/78 (6%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXP-----PXXPPPXXXXXXXXXXXXXXFVXGGGXXX 700 PPP G PPPPP P P PPP GG Sbjct: 1037 PPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGG---- 1092 Query: 699 XXXKKXPXPPPPXXGGXF 646 P PPPP GG F Sbjct: 1093 --FGGPPPPPPPPPGGAF 1108 Score = 33.5 bits (73), Expect = 9.8 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = -2 Query: 866 PPPPXXXX--GGXEXXP---PPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPPG P PPP P Sbjct: 1021 PPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPP 1059 Score = 33.5 bits (73), Expect = 9.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPG 804 PPPP G PPPPPPG Sbjct: 1098 PPPPPPPGGAFGVPPPPPPPG 1118 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 44.0 bits (99), Expect = 0.007 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 394 PPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPP 427 Score = 42.3 bits (95), Expect = 0.021 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 378 PPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPP 409 Score = 39.9 bits (89), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 378 PPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPP 411 Score = 39.1 bits (87), Expect = 0.20 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 364 PPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPP 397 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 377 PPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPP 410 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 376 PPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPP 409 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 375 PPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPP 408 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP-PGXXXXXPXXPPPXP 765 PPP G PPPPP PG P PPP P Sbjct: 379 PPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPP 413 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP P PPP Sbjct: 405 PPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPP 436 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 43.6 bits (98), Expect = 0.009 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPPG P PPP Sbjct: 441 PPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPP 472 Score = 43.2 bits (97), Expect = 0.012 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G G PPPPPP P PPP GGG Sbjct: 454 PPPPPPPGMGGAPPPPPPP----PFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPG 509 Query: 684 XPXPPPPXXGG 652 PPPP GG Sbjct: 510 GGPPPPPPIGG 520 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 440 PPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPP 473 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 425 PPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPP 458 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP P PPP P Sbjct: 442 PPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFP 475 Score = 35.5 bits (78), Expect = 2.4 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 7/78 (8%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXX----PPXXPPPXXXXXXXXXXXXXXFVXGG---GX 706 PPP G G PPPPPP PP PPP GG Sbjct: 425 PPPPLPPGVGAPPPPPPPPPPPLPGGSCIPP--PPPPPGMGGAPPPPPPPPFPGGVPPPP 482 Query: 705 XXXXXKKXPXPPPPXXGG 652 P PPPP GG Sbjct: 483 PLPGGAPPPPPPPPFPGG 500 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 454 PPPPPPPGMGGAPPPPPPPPFPGGVPP--PPPLP 485 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPP PG P PPP P Sbjct: 468 PPPPPPFPGGVP--PPPPLPG-GAPPPPPPPPFP 498 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXP---PPXP 765 PPPP G PPPP PG P P PP P Sbjct: 456 PPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPPP 492 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXP---PPXP 765 PPPP G PPPP PG P P PP P Sbjct: 479 PPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPP 515 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP-----PGXXXXXPXXPPP 771 PPPP G PPPPP PG P PPP Sbjct: 424 PPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPP 460 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPP PPP P Sbjct: 426 PPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPP 459 >UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whole genome shotgun sequence; n=7; Euteleostomi|Rep: Chromosome undetermined SCAF14625, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 496 Score = 42.7 bits (96), Expect = 0.016 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G G PPPPPP P PPP GG +K Sbjct: 291 PPPPARGSRGA--PPPPPPSRAPASAPPPPPPTRPGSLGAPPPPPPTTRGGHQVAPPHQK 348 Query: 684 XPXPPP 667 P PPP Sbjct: 349 TPPPPP 354 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP PPP Sbjct: 288 PPPPPPPARGSRGAPPPPPPSRAPASAPPPPP 319 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP GG PPPPP P PPP Sbjct: 277 PPPPPGRGGAPPPPPPPPARGSRGAPPPPPP 307 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP G G PPPPPP P PPP Sbjct: 277 PPPPPGRGGAPPPPPPPPARGSRGAPPPPPP 307 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP P PPP Sbjct: 289 PPPPPPARGSRGAPPPPPPSRAPASAPPPPPP 320 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 42.3 bits (95), Expect = 0.021 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 597 PPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPP 628 Score = 42.3 bits (95), Expect = 0.021 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 598 PPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPP 629 Score = 41.5 bits (93), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPP P PPP Sbjct: 598 PPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPP 629 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 596 PPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPP 629 Score = 40.3 bits (90), Expect = 0.085 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PP P Sbjct: 610 PPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAP 643 Score = 39.5 bits (88), Expect = 0.15 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G E PPPPPP PPP P Sbjct: 580 PPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPP 613 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 583 PPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPP 616 Score = 38.7 bits (86), Expect = 0.26 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP---GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 581 PPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPP 617 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 595 PPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPP 628 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 42.3 bits (95), Expect = 0.021 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 615 PPPPALGAMGAPPPPPPPPPSAAGLPPPPPPP 646 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 615 PPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLP 648 Score = 38.7 bits (86), Expect = 0.26 Identities = 22/70 (31%), Positives = 23/70 (32%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G PPPPPP P PPP + G G Sbjct: 600 PPPALGGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAG-------P 652 Query: 684 XPXPPPPXXG 655 P PPPP G Sbjct: 653 PPPPPPPLPG 662 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 626 PPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPP 659 Score = 37.5 bits (83), Expect = 0.60 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP---GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 598 PPPPPALGGVPPPPPPPPPPPALGAMGAPPPPPPPPP 634 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 640 PPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPP 671 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 613 PPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPP 646 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 640 PPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPP 671 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 641 PPPPPPLPGAGP--PPPPPPPLPGAGPPPPPPPP 672 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 654 PPPPPPLPGAGP--PPPPPPPLSGAGPPPPPPMP 685 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 612 PPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPP 645 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 PPP G PPPPPP PP PP Sbjct: 653 PPPPPPPLPGAGPPPPPPPPLSGAGPPPPPP 683 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 628 PPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLP 661 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 42.3 bits (95), Expect = 0.021 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 602 PPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPP 633 Score = 41.9 bits (94), Expect = 0.028 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG P PPP P Sbjct: 588 PPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPP 621 Score = 41.9 bits (94), Expect = 0.028 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 602 PPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPP 633 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPPG P PPP Sbjct: 537 PPPPPPPPGLVPPPPPPPPGASLVPPPPPPP 567 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 P PP G PPPPPPG P PPP Sbjct: 575 PSPPPGAAGLVPPPPPPPPPGASLVPPPPPPP 606 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 600 PPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPP 633 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP PPPPPPG P PP Sbjct: 549 PPPPPPPGASLVPPPPPPPPGAPGLVPSPPP 579 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP G PPPPPP PP PPP Sbjct: 576 SPPPGA-AGLVPPPPPPPPPGASLVPPPPPPPP 607 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PP P Sbjct: 614 PPPPPPPPGAGGIPPPPPPPG--AGIPPPPPGVP 645 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 537 PPPPPPPPG--LVPPPPPPPPGASLVPPPPPPPP 568 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP G PPPPPP PP PPP Sbjct: 537 PPPPPPPPGLVPPPPPPPPGASLVPPPPPPP 567 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPP P PPP P Sbjct: 561 PPPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPP 594 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P P G PPPPPP P PPP P Sbjct: 575 PSPPPGAAGLVPPPPPPPPPGASLVPPPPPPPP 607 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 PPP G G PPPPPP PP P Sbjct: 615 PPPPPPPGAGGIPPPPPPPGAGIPPPPPGVP 645 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXP--PPXP 765 PPPP GG PPPP G P P PP P Sbjct: 616 PPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPP 651 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 538 PPPPPPPGL-VPPPPPPPPGASLVPPPPPPPP 568 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP PPP Sbjct: 548 PPPPPPPPGASLVPPPPPPPPGAPGLVPSPPP 579 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 42.3 bits (95), Expect = 0.021 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 663 PPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPP 696 Score = 39.9 bits (89), Expect = 0.11 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 678 PPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPP 709 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 677 PPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPP 708 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 662 PPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPP 695 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP P PPP P Sbjct: 664 PPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPP 697 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 678 PPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPP 709 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP P PPP Sbjct: 677 PPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPP 708 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 689 PPPPPPPPPSKTGAPPPPPPPRIGGAPPPPPP 720 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 674 PPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPP 707 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 660 PPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPP 693 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 676 PPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPP 709 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 661 PPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPP 694 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 675 PPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPP 708 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 645 PPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPP 678 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 646 PPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPP 679 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 648 PPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPPP 681 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 42.3 bits (95), Expect = 0.021 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G PPPPPP PP PPP G + Sbjct: 345 PPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPR 404 Query: 684 XPXPPPP 664 P PPPP Sbjct: 405 PPGPPPP 411 Score = 41.5 bits (93), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPP P PPP Sbjct: 358 PPPPPPLPGGARPPPPPPPPFGNAPPPPPPPP 389 Score = 40.3 bits (90), Expect = 0.085 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 332 PPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLP 365 Score = 39.9 bits (89), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PP P Sbjct: 370 PPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGP 403 Score = 38.3 bits (85), Expect = 0.34 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP-PGXXXXXPXXPPP 771 PPPP G + PPPPP PG P PPP Sbjct: 345 PPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPP 377 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G PPPPPP PP PPP Sbjct: 357 APPPPPPLPGGARPPPPPPPPFGNAPPPPPPPP 389 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP G P PPP P Sbjct: 382 PPPPPPPPGSKIPGPPPPPGG---PRPPGPPPPP 412 Score = 35.1 bits (77), Expect = 3.2 Identities = 20/72 (27%), Positives = 22/72 (30%), Gaps = 1/72 (1%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXP-PXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 PPP PPPPPP P PPP + Sbjct: 296 PPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQ 355 Query: 687 KXPXPPPPXXGG 652 + P PPPP GG Sbjct: 356 QAPPPPPPLPGG 367 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 315 PPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPP 348 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 316 PPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPP 349 >UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 9.t00033 - Entamoeba histolytica HM-1:IMSS Length = 540 Score = 41.9 bits (94), Expect = 0.028 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 875 FFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 F PPPP GG PPPPPP PPP P Sbjct: 353 FNAPPPPPPSYGGHHNVPPPPPPAFDTGCGVPPPPPP 389 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 385 PPPPPARGTGCGAPPPPPPPAFDTGCGIPPPPPP 418 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 384 PPPPPPARGTGCGAPPPPPPPAFDTGCGIPPPPP 417 Score = 35.1 bits (77), Expect = 3.2 Identities = 21/73 (28%), Positives = 21/73 (28%), Gaps = 2/73 (2%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP--XXXXXXXXXXXXXXFVXGGGXXXXXX 691 PPP G G PPPP PP PPP G Sbjct: 373 PPPAFDTGCGVPPPPPPARGTGCGAPPPPPPPAFDTGCGIPPPPPPARGTGCGAPPPPPP 432 Query: 690 KKXPXPPPPXXGG 652 P PPPP G Sbjct: 433 LNAPPPPPPPAHG 445 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP PPP P Sbjct: 371 PPPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPP 404 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 400 PPPPPAFDTGC-GIPPPPPPARGTGCGAPPPPPP 432 >UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_34, whole genome shotgun sequence - Paramecium tetraurelia Length = 1131 Score = 41.9 bits (94), Expect = 0.028 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPP--PPPPGXXXXXPXXPPPXP 765 PPPP GG PP PPPPG P PPP P Sbjct: 635 PPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPP 670 Score = 41.5 bits (93), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 638 PPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPP 669 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P P P Sbjct: 649 PPPPPPPPGAKAGGPPPPPPPPGGKAPPLPNAKP 682 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP G P P P Sbjct: 652 PPPPPGAKAGGPPPPPPPPGGKAPPLPNAKPAVP 685 >UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to Formin homology 2 domain containing 1 (LOC787862), mRNA.; n=1; Bos taurus|Rep: PREDICTED: Bos taurus similar to Formin homology 2 domain containing 1 (LOC787862), mRNA. - Bos Taurus Length = 1125 Score = 41.5 bits (93), Expect = 0.037 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 534 PPPPPLLSGSLPPPPPPPPPPLKSPFPPTPPPPP 567 >UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis thaliana|Rep: F23H11.22 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 929 Score = 41.5 bits (93), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKKX 682 PP G PPPPPP PP PP G KK Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKG 431 Query: 681 PXPPP 667 P PP Sbjct: 432 PPKPP 436 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G PPPPPP P PPP Sbjct: 394 APPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 41.5 bits (93), Expect = 0.037 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 179 PPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPP 212 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PP PPPG P PPP Sbjct: 205 PPPPPPPPGGRPSAPPLPPPGGRASAPPPPPP 236 Score = 39.5 bits (88), Expect = 0.15 Identities = 23/71 (32%), Positives = 24/71 (33%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 +PP GG PPPPPP PP PPP GG Sbjct: 218 APPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGG-------- 269 Query: 687 KXPXPPPPXXG 655 P PPPP G Sbjct: 270 --PPPPPPPGG 278 Score = 39.5 bits (88), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPP PG P PPP Sbjct: 244 PPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPP 275 Score = 38.7 bits (86), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPPG P PPP Sbjct: 193 PPPPPPPGARPGPPPPPPPPGGRPSAPPLPPP 224 Score = 37.9 bits (84), Expect = 0.45 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP PPPPPP PP PPP + Sbjct: 145 PPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPP-PPPPGARP 203 Query: 684 XPXPPPPXXGG 652 P PPPP GG Sbjct: 204 GPPPPPPPPGG 214 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 130 PPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPP 163 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPP PPP P Sbjct: 31 PPPPRSGVGGNTPPAPPPPPLRSTVPAISPPPPP 64 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 144 PPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPP 177 Score = 36.3 bits (80), Expect = 1.4 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G PPPPPP P PPP G Sbjct: 193 PPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGA--------- 243 Query: 684 XPXPPPPXXGG 652 P PPPP GG Sbjct: 244 PPPPPPPGAGG 254 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P P P Sbjct: 257 PPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAP 290 Score = 35.9 bits (79), Expect = 1.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 S PP G PPPPPP P PPP GG Sbjct: 217 SAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPP 276 Query: 687 KXPXPPPPXXGG 652 PPPP G Sbjct: 277 GGRAPPPPRGPG 288 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP P P PPP P Sbjct: 116 PPPPPPPISHSNAPPPPPLPAARFNAPPPPPPPP 149 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 129 PPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPP 162 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPP P PP P Sbjct: 30 PPPPPRSGVGGNTPPAPPPPPLRSTVPAISPPPP 63 Score = 34.3 bits (75), Expect = 5.6 Identities = 20/73 (27%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPP--PPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXX 694 +PPP PPP PPP PP PPP Sbjct: 128 APPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPG 187 Query: 693 XKKXPXPPPPXXG 655 + P PPPP G Sbjct: 188 ARPGPPPPPPPPG 200 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP-----PPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPP P PPP P Sbjct: 159 PPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPP 197 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP P PPP Sbjct: 178 SPPPPPPPPGARPGPPPPPPPPGARPGPPPPPP 210 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 65 PPPPLKPSSGAPCPPPPPPP------PPPPPP 90 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGG---XEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 86 PPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPP 122 >UniRef50_Q54ER5 Cluster: Formin homology domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Formin homology domain-containing protein - Dictyostelium discoideum AX4 Length = 2546 Score = 41.5 bits (93), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPP P PPP Sbjct: 1065 PPPPGKSSGGGPPPPPPPPPKGGKGGPPPPPP 1096 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP P PPP Sbjct: 1065 PPPPGKSSGGGPPPPPPPPPKGGKGGPPPPPP 1096 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP PPP Sbjct: 1064 PPPPPGKSSGGGPPPPPPPPPKGGKGGPPPPP 1095 >UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1074 Score = 41.5 bits (93), Expect = 0.037 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 575 PPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPPP 608 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP GG PPPPPP P PPP Sbjct: 574 SPPPPISGGGAPPPPPPPPPPPSGGGAPPPPPP 606 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP GG PPPPPP PPP P Sbjct: 573 PSPPPPISGGGAPPPPPPPPPPPSGGGAPPPPPP 606 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP-GXXXXXPXXPPPXP 765 PPPP G PPPPP G P PP P Sbjct: 591 PPPPPSGGGAPPPPPPPPPSGGKKAGAPGAPPTGP 625 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 41.5 bits (93), Expect = 0.037 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 872 FFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 F PPPP G PPPPPPG P PPP Sbjct: 952 FPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPP 985 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 966 PPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPP 997 Score = 39.1 bits (87), Expect = 0.20 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 FPPPP G PPPPPP P PPP P Sbjct: 952 FPPPPPPPPPGV-GGPPPPPPPPGMGGPPPPPPPP 985 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 953 PPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPP 984 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG PPPPPP PP PPP Sbjct: 958 PPPPGVGG----PPPPPPPPGMGGPPPPPPPP 985 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 968 PPPPPPGMGG----PPPPPP-PPGAGPGGPPPPP 996 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP P PPP Sbjct: 967 PPPPPPPGMGGP-PPPPPPPGAGPGGPPPPPP 997 Score = 33.9 bits (74), Expect = 7.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPG 804 PPPP G PPPPPPG Sbjct: 978 PPPPPPPPGAGPGGPPPPPPG 998 >UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1561 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 1036 PPPPPPISGAPPPPPPPPPPMKGGAGPPPPPPPP 1069 Score = 35.9 bits (79), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPG 804 PPPP GG PPPPPPG Sbjct: 1050 PPPPPPMKGGAGPPPPPPPPG 1070 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPP----XXPPP 769 PPP GG G PPPPP PP PPP Sbjct: 1052 PPPPMKGGAGPPPPPPPPGKLGAKKPPAGVQCRPPP 1087 >UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 461 Score = 41.1 bits (92), Expect = 0.049 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP PPP P Sbjct: 295 PPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPPP 328 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP PPP P Sbjct: 294 PPPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPP 327 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPP P P P Sbjct: 310 PPPPPAAAGGAGVPPPPPPPPPPANLPPLPSP 341 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPP P PPP P Sbjct: 281 PPPPPSDGSLPPPPPPPPGAPGGGAPPPPPPPP 313 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP-----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 293 PPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPPPPPP 331 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G PPPPP PP PPP Sbjct: 280 APPPPPSDGSLPPPPPPPPGAPGGGAPPPPPPP 312 Score = 33.9 bits (74), Expect = 7.4 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXX--PXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 281 PPPPPSD--GSLPPPPPPPPGAPGGGAPPPPPPPPP 314 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 41.1 bits (92), Expect = 0.049 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = -1 Query: 870 FSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXX 691 F PPP G PPPPPP PP PPP G Sbjct: 125 FMPPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAG 184 Query: 690 KKXPXPPPP 664 P P PP Sbjct: 185 PPVPPPHPP 193 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 873 FFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 F PPP G PPPPPP PP PP Sbjct: 125 FMPPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPP 158 >UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein; n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 505 Score = 41.1 bits (92), Expect = 0.049 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 +PPPP PPPPPP P PPP P Sbjct: 343 YPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPP 377 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PP P Sbjct: 359 PPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 360 PPPPSVLGVGPVAPPPPPP---PPPPPGPPPP 388 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP--GXXXXXPXXPPPXP 765 PPPP PPPPP G P PPP P Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPP 380 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G + PPPP PG P PPP P Sbjct: 558 PPPPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMP 591 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPP PG P PPP P Sbjct: 587 PPPMPEMMSGPPPPPPPPMPGMMSGPPPPPPPIP 620 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 570 PPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPP 603 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP-GXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 599 PPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPPP 633 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP---PGXXXXXPXXPPP 771 PPPP G PPPPP PG P PPP Sbjct: 598 PPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPP 632 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPP PP PPP Sbjct: 601 PPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPP 632 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP P PPP Sbjct: 600 PPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPP 631 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPP P PP PPP Sbjct: 573 PPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPP 604 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 583 PPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPPP 616 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPP PPP P Sbjct: 613 PPPPPPIPGMMTGPPSPPPPPLVATVVGPPPPLP 646 >UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like - Strongylocentrotus purpuratus Length = 801 Score = 40.7 bits (91), Expect = 0.064 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPPG P PPP Sbjct: 256 PPPPPPMMGGAPP-PPPPPPGPGGAPPPPPPP 286 Score = 37.9 bits (84), Expect = 0.45 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP GG PPPPPP PP PPP GG + Sbjct: 258 PPPPMMGGA---PPPPPPPPGPGGAPPPPPPPGMFGGGGPPPPPGAPPFGGMSAPIKKRD 314 Query: 684 XPXPPPP 664 P P P Sbjct: 315 LPKPSNP 321 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG PPP Sbjct: 267 PPPPPPPPGPGGAPPPPPPPGMFGGGGPPPPP 298 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 FPPPP PPPPPP P PPP P Sbjct: 1065 FPPPPADTSAAFIAAPPPPPPPAPVTGPTPPPPPP 1099 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P P P Sbjct: 1083 PPPPAPVTGPTPPPPPPPPPPPPPPAPVTGPTPP 1116 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 39.9 bits (89), Expect = 0.11 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPPG P PPP Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPP---PXXXXXXPPXXPPP 769 SPPP G G PPPPP P PP PPP Sbjct: 576 SPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 510 PPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 549 PPPPPPPPGTQAAPPPPPPPPMQNRAP-SPPPMP 581 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 592 PPPPPMPLANGATPPPPPPPMAMANGAAGPPPPP 625 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP PPP P Sbjct: 593 PPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP PPP P Sbjct: 608 PPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPP 641 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPP PPP P Sbjct: 577 PPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP 542 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP GG PPPPPP P PPP P Sbjct: 551 PPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPP 584 Score = 39.5 bits (88), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 565 PPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPP 596 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 565 PPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPP 596 Score = 39.1 bits (87), Expect = 0.20 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 566 PPPPPPSSGGG---PPPPPPPPSSGGPPPPPPPP 596 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 550 PPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPP 583 Score = 34.3 bits (75), Expect = 5.6 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 +P G PPPP P PP PPP GG Sbjct: 536 APSSPSLGAPPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGG------- 588 Query: 687 KXPXPPPPXXGG 652 P PPPP GG Sbjct: 589 --PPPPPPPPGG 598 >UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1505 Score = 40.7 bits (91), Expect = 0.064 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 876 FFFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 FF PP GG PPPPPP PP PPP Sbjct: 949 FFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 984 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 878 FFFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 FF PPP G PPPPP G P PPP Sbjct: 949 FFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 984 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 872 FFPPPPXXXXGGXEXXPPPPPPG 804 F PPPP GG P PPPPG Sbjct: 963 FPPPPPPPPGGGVPGPPKPPPPG 985 >UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1128 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG P PPP P Sbjct: 597 PPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPP 630 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPP G P PPP P Sbjct: 584 PPPTDLAGAPPVAPPPPPVGAPPPPPPPPPPPP 616 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G PPPPPP P PPP Sbjct: 596 APPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPP 628 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPPG P PPP Sbjct: 611 PPPPPPGVAAAAPPPPPPPPGLAGLVP--PPP 640 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP GG PPPPPPG P PPP P Sbjct: 499 PPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPP 531 Score = 39.5 bits (88), Expect = 0.15 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXP--PP 769 PPP GG G PPPPPP PP P PP Sbjct: 512 PPPPPPGGMGGVPPPPPPPPPGGMPPPPAPALPP 545 Score = 39.1 bits (87), Expect = 0.20 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 510 PPPPPPPPGGMGGVPPPPPPPPPGGMP--PPPAP 541 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P G PPPPP G P PPP P Sbjct: 499 PPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPP 532 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P P P Sbjct: 511 PPPPPPPGGMGGVPPPPPPPPPGGMPPPPAPALP 544 >UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Protein enabled - Drosophila melanogaster (Fruit fly) Length = 829 Score = 40.7 bits (91), Expect = 0.064 Identities = 22/70 (31%), Positives = 23/70 (32%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP GG PPPP P P PPP + GG Sbjct: 556 PPPPSFGGAAGGGPPPPAPPQMFNGAP--PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPG 613 Query: 684 XPXPPPPXXG 655 P PPPP G Sbjct: 614 APPPPPPPPG 623 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 40.7 bits (91), Expect = 0.064 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP GG PPPP PG P PPP P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PP P GG PPPP PG P PPP Sbjct: 529 PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 525 PPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPP 558 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGGP-PPPPMP 572 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXP 775 PPP G G PPPPPP PP P Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 P P GG PPPP P PP PPP Sbjct: 530 PMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 40.3 bits (90), Expect = 0.085 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXP---PPXP 765 PPPP GG PPPPPPG P P PP P Sbjct: 587 PPPPPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPP 623 Score = 39.5 bits (88), Expect = 0.15 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP PPP P Sbjct: 571 PPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPP 604 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 574 PPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPP 605 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPPG P PPP Sbjct: 575 PPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPP 606 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 572 PPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPP 605 Score = 35.9 bits (79), Expect = 1.8 Identities = 25/71 (35%), Positives = 26/71 (36%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP GG PPPPPP PP PPP GG + Sbjct: 554 PPPPPPGGLLTAPPPPPPP------PP--PPPPGGSLTAPPPPPPPPPPGG--------R 597 Query: 684 XPXPPPPXXGG 652 P PPPP GG Sbjct: 598 LPPPPPPPPGG 608 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP---PPPPPGXXXXXPXXPPPXP 765 PPPP P PPPPPG P PPP P Sbjct: 556 PPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPP 592 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG P PPP P Sbjct: 548 PPPPPP--------PPPPPPGGLLTAPPPPPPPP 573 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP PPP P Sbjct: 570 PPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPP 603 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPP G P PPP P Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPP 574 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 39.9 bits (89), Expect = 0.11 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPPG P PPP Sbjct: 605 PPPPPPPGASSIPPPPPPPGMPGMPPPPPPP 635 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPPG P PPP Sbjct: 617 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPP 647 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPPG P PPP Sbjct: 629 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPP 659 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 618 PPPPPPGMPGM--PPPPPPPGMPGMPPPPPPP 647 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPPG P PP P Sbjct: 641 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMP 673 Score = 35.9 bits (79), Expect = 1.8 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G PPPPPP PP PPP Sbjct: 606 PPPPPPGASSI--PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPG 663 Query: 684 XPXPPPPXXGG 652 P PPPP G Sbjct: 664 MPPPPPPGMPG 674 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 653 PPPPPPP--GMPGMPPPPPPG----MPGMPPPPP 680 >UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: FH2 domain protein - Entamoeba histolytica HM-1:IMSS Length = 1212 Score = 39.9 bits (89), Expect = 0.11 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPPG P PPP Sbjct: 624 PPPPPPPGASSVPPPPPPPGASSVPPPPPPP 654 Score = 39.9 bits (89), Expect = 0.11 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPPG P PPP Sbjct: 636 PPPPPPPGASSVPPPPPPPGMPGMPPPPPPP 666 Score = 38.3 bits (85), Expect = 0.34 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 613 PPPPPP--GASSVPPPPPPPGASSVPPPPPPP 642 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G PPPPPP PP PPP Sbjct: 612 APPPPPPGASSV--PPPPPPPGASSVPPPPPPP 642 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPPG P PPP P Sbjct: 648 PPPPPPPGMPGMPPPPPPPGMPGMPP--PPPLP 678 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 625 PPPPPPGASSV--PPPPPPPGASSVPPPPPPP 654 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 637 PPPPPPGASSV--PPPPPPPGMPGMPPPPPPP 666 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 39.9 bits (89), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 1096 PPPPPPMPGMAGMPPPPPPPPPMPGMPGMPPPPP 1129 Score = 39.5 bits (88), Expect = 0.15 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP--PGXXXXXPXXPPPXP 765 PPPP G PPPPP PG P PPP P Sbjct: 1098 PPPPMPGMAGMPPPPPPPPPMPGMPGMPPPPPPPMP 1133 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 860 PPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP GG PPPPPP PPP P Sbjct: 1082 PPMPGAGGPPPPPPPPPPPPMPGMAGMPPPPP 1113 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PP P P PPP P Sbjct: 1067 PPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPP 1100 >UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pombe|Rep: Formin-3 - Schizosaccharomyces pombe (Fission yeast) Length = 1461 Score = 39.9 bits (89), Expect = 0.11 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP GG PPPPPPG P PPP P Sbjct: 752 PPPAPIMGGPP--PPPPPPGVAGAGPPPPPPPP 782 >UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; Suberites domuncula|Rep: Wiskott-Aldrich syndrome protein - Suberites domuncula (Sponge) Length = 410 Score = 39.5 bits (88), Expect = 0.15 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 297 PPPPSNSRGGSAPAPPPPPP---VGVPAPPPPPP 327 Score = 35.5 bits (78), Expect = 2.4 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP GG G PPPP P PPP V G G Sbjct: 284 PPPPPRGGPGRGGPPPPSNSRGGSAPAPPPPP---PVGVPAPPPPPPVGGTGPPKPPSAA 340 Query: 684 XPXPPPP 664 PPPP Sbjct: 341 GGPPPPP 347 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 39.5 bits (88), Expect = 0.15 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PPP P Sbjct: 509 PPPPPLANYGAPPPPPPPPPG-SGSAPPPPPPAP 541 Score = 38.7 bits (86), Expect = 0.26 Identities = 23/70 (32%), Positives = 25/70 (35%) Frame = -1 Query: 873 FFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXX 694 F +PPP PPPPPP PP PPP + GGG Sbjct: 497 FVAPPPPPP-----PPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG---- 547 Query: 693 XKKXPXPPPP 664 P PPPP Sbjct: 548 ---IPPPPPP 554 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 520 PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 553 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP PPP P Sbjct: 521 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 554 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 506 PPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 >UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: actin binding protein - Entamoeba histolytica HM-1:IMSS Length = 986 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP G PPPPPPG P PP Sbjct: 516 PPPPPGVPGATGVPPPPPPPGMPGAPPPPPP 546 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPP P PPP Sbjct: 516 PPPPPGVPGATGVPPPPPPPGMPGAPPPPPP 546 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 183 PPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPP 214 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 182 PPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPP 213 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPP P PPP Sbjct: 183 PPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPP 214 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 167 PPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPP 200 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPG PPP P Sbjct: 166 PPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPP 199 >UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: Enabled homolog - Rattus norvegicus (Rat) Length = 526 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 291 PPPPPPLPSAGPPPPPPPPPPLPNQVPPPPPPPP 324 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP P PPP P Sbjct: 293 PPPPLPSAGPPPPPPPPPPLPNQVPPPPPPPPAP 326 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 284 PPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAP 317 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAP 305 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPP 248 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 37.9 bits (84), Expect = 0.45 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 SPPP PPPPPP PP PPP Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Query: 687 KXPXPPPP 664 P PPPP Sbjct: 288 PPPPPPPP 295 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHP 704 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 676 PPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPP 257 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP P P PPP P Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PP Sbjct: 678 SPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 681 PPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVP 714 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 238 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 239 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 216 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 228 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSP 264 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 236 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 241 PPPPPPPPPPPSPPPPPPPPS---PSPPPPPPSP 271 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 252 SPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPP 284 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPP 261 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPP 274 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPP 260 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 248 SPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPP 258 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 224 PSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPP 257 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPP 259 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP P P PPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 >UniRef50_Q9GYL4 Cluster: Putative uncharacterized protein R04E5.8; n=2; Caenorhabditis elegans|Rep: Putative uncharacterized protein R04E5.8 - Caenorhabditis elegans Length = 997 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 126 PPPRKSRAGGSSPPPPPPPRVPRTPPPRSPPP 157 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PP Sbjct: 125 PPPPRKSRAGGSSPPPPPPPRVPRTPPPRSPP 156 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PP Sbjct: 125 PPPPRKSRAGGSSPPPPPPPRVPRTPPPRSPP 156 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP GG PPPPP P PPP Sbjct: 126 PPPRKSRAGGSSPPPPPPPRVPRTPPPRSPPP 157 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 39.1 bits (87), Expect = 0.20 Identities = 20/64 (31%), Positives = 22/64 (34%) Frame = -1 Query: 825 PPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKKXPXPPPPXXGGXF 646 P PPPP PP PPP + GGG PPP GG Sbjct: 582 PAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPPPGGGG 641 Query: 645 FYLY 634 F L+ Sbjct: 642 FGLF 645 Score = 39.1 bits (87), Expect = 0.20 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 584 PPPPPMMGGGPP--PPPPPPMMGGGGPPPPPPPP 615 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP GG PPPPPP P PP Sbjct: 596 PPPPPPMMGGGGPPPPPPPPMMGGGPPPPPP 626 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG G PPPPPP P PPP Sbjct: 598 PPPPMMGGGG---PPPPPPPPMMGGGPPPPPP 626 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 548 PPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGP 581 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 537 PPPPSAPGAGIP--PPPPVPGNAPPPPPPPPPPP 568 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G G PPP P PP PPP Sbjct: 536 APPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPP 568 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PP P Sbjct: 560 PPPPPPPPPGAGAPPPPPPPG-----PGLAPPPP 588 >UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 1083 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 593 PPPVQQTGTSLPPPPPPPPIQTTGGPPPPPPP 624 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 591 PPPPPVQQTGTSLPPPPPPPPIQTTGGPPPPPPP 624 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 590 PPPPPPVQQTGTSLPPPPPPPPIQTTGGPPPPPP 623 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 568 PPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPP 599 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 567 PPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPP 600 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP P PPP P Sbjct: 569 PPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAP 602 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 +P P G PPPPPP P PPP P Sbjct: 429 YPVSPPPTSGPAAPPPPPPPPPPPPPPPLPPPPLP 463 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PP Sbjct: 432 SPPPTSGPAAPPPPPPPPPPPPPPPLPPPPLPP 464 >UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda|Rep: Protein enabled homolog - Homo sapiens (Human) Length = 591 Score = 39.1 bits (87), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 337 PPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXPXXXXXXXFFF 735 PPPP G PPPPPP P PPP P FF Sbjct: 338 PPPPLPSTG---PPPPPPPPPLPNQVPPPPPPPPAPPLPASGFF 378 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP P PPP P Sbjct: 337 PPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXPXXXXXXXFF 738 PPPP PPPPPP P PPP FF Sbjct: 336 PPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFF 378 >UniRef50_Q5CHL3 Cluster: Hydroxyproline-rich glycoprotein dz-hrgp; n=8; Cryptosporidium|Rep: Hydroxyproline-rich glycoprotein dz-hrgp - Cryptosporidium hominis Length = 328 Score = 31.9 bits (69), Expect(2) = 0.21 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 825 PPPPPPXXXXXXPPXXPPP 769 PPPPPP PP PPP Sbjct: 230 PPPPPPPPPPSPPPQSPPP 248 Score = 26.2 bits (55), Expect(2) = 0.21 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPP 808 P P GG G PPP PP Sbjct: 192 PVPYQQGGSGFPPPPPLPP 210 >UniRef50_Q6ML35 Cluster: Putative uncharacterized protein; n=1; Bdellovibrio bacteriovorus|Rep: Putative uncharacterized protein - Bdellovibrio bacteriovorus Length = 265 Score = 38.7 bits (86), Expect = 0.26 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = -1 Query: 870 FSPPPXXX--GGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXX 697 F PPP GG G P P P PP PPP GGG Sbjct: 196 FPPPPTFDDFGGDGGYVPAPNMPEDYGDIPPPPPPPPPPPFGDD--------FGGGFGGD 247 Query: 696 XXKKXPXPPPPXXGGXFF 643 P PPPP GG F Sbjct: 248 SDFPPPPPPPPFEGGGDF 265 >UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|Rep: Adhesin FhaB - Bordetella avium Length = 2621 Score = 38.7 bits (86), Expect = 0.26 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP P PPP P Sbjct: 2330 PPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPP 2363 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 2346 PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP 2379 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 2362 PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP 2395 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 2395 PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP 2428 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 2411 PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP 2444 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 2444 PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP 2477 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 2460 PPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP 2493 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 2376 PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPP 2409 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 2425 PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPP 2458 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 2344 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2377 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 2360 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2393 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 2393 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2426 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 2409 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2442 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 2442 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2475 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 2458 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2491 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 2379 PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPP 2412 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 2428 PPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPP 2461 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 2328 PPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPP 2361 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2378 PPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPP 2411 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2427 PPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPP 2460 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2345 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2378 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2361 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2394 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2394 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2427 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2410 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2443 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2443 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2476 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2459 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2492 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2329 PPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPP 2362 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2343 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP 2376 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2359 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP 2392 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2377 PPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPP 2410 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2392 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP 2425 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2408 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP 2441 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2426 PPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPP 2459 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2441 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP 2474 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 2457 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP 2490 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 38.7 bits (86), Expect = 0.26 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 455 PPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAP 488 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 467 PPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPP 498 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 468 PPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPP 499 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 468 PPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPPCP 501 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 441 PPAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPP 474 >UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; Dictyostelium discoideum|Rep: Diaphanous-related formin dDia2 - Dictyostelium discoideum (Slime mold) Length = 1087 Score = 38.7 bits (86), Expect = 0.26 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXP 777 PPPP GG PPPPPPG P P Sbjct: 596 PPPPPPMSGGGGPPPPPPPPGGKSNKPAKP 625 Score = 33.1 bits (72), Expect(2) = 1.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 837 GXXXPPPPPPXXXXXXPPXXPPP 769 G PPPPPP PP PPP Sbjct: 592 GSPPPPPPPPMSGGGGPPPPPPP 614 Score = 21.8 bits (44), Expect(2) = 1.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 681 PXPPPPXXGG 652 P PPPP GG Sbjct: 608 PPPPPPPPGG 617 >UniRef50_A2F9Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 214 Score = 38.7 bits (86), Expect = 0.26 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPPG PPP P Sbjct: 105 PPPPAADGAPAPPPPPPPPGAGADGQAPPPPPP 137 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 38.7 bits (86), Expect = 0.26 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP GG PPPPPP P PP Sbjct: 533 PPPPPPPAGGAPPPPPPPPPKGGAPPPPPPP 563 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 522 PPPPPPPGAGAP-PPPPPPAGGAPPPPPPPPP 552 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG PPPPPP PP PPP Sbjct: 535 PPPPPAGGA---PPPPPPPPPKGGAPPPPPPP 563 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PP P Sbjct: 546 PPPPPPPKGGAP--PPPPPPARAPPPPAGTPPPP 577 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 522 PPPPPPPGAG---APPPPPPPAGGAPPPPPPPPP 552 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 +PPP G PPPPPP PP PP Sbjct: 532 APPPPPPPAGGAPPPPPPPPPKGGAPPPPPPP 563 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXP---PPXP 765 PPPP G PPPPP G P P PP P Sbjct: 534 PPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPP 570 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP P PPP Sbjct: 545 PPPPPPPPKGGAPPPPPPPARAPPPPAGTPPP 576 Score = 31.1 bits (67), Expect(2) = 6.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 PP G G PPPPPP PP PP Sbjct: 511 PPAPPLPGAGV--PPPPPPPGAGAPPPPPPP 539 Score = 21.8 bits (44), Expect(2) = 6.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 681 PXPPPPXXGG 652 P PPPP GG Sbjct: 533 PPPPPPPAGG 542 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPP 524 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 35.1 bits (77), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 846 GGXGXXXPPPPPPXXXXXXPPXXPPP 769 GG PPPPPP PP PPP Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPP 507 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 503 PSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 486 PPPPPPPP--PPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP P P PPP P Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG P P P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIP 548 >UniRef50_A4LPA5 Cluster: Intracellular motility protein A; n=6; Burkholderia pseudomallei|Rep: Intracellular motility protein A - Burkholderia pseudomallei 305 Length = 496 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 P PP GG PPPPPPG PPP Sbjct: 30 PVPPPMPGGGANIPPPPPPPGGIGGATPSPPP 61 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 P PP GG PPP PG P PPP Sbjct: 17 PVPPPMPGGGANIPVPPPMPGGGANIPPPPPP 48 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPP G P PP P Sbjct: 32 PPPMPGGGANIPPPPPPPGGIGGATPSPPPLTP 64 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSP 262 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 216 SPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXP-PPPPPGXXXXXPXXPPPXP 765 +PPPP P PPPPP P PPP P Sbjct: 204 YPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSP 239 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 218 PPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 251 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 249 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 227 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 210 PPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SP P PPPPPP PP PPP Sbjct: 214 SPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPP 246 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PP Sbjct: 226 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPP 258 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 423 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 456 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 431 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 267 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 299 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 324 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 356 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 368 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 400 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 422 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 454 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 482 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 514 Score = 36.3 bits (80), Expect = 1.4 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP PPPPPP PP PPP Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Query: 684 XPXPPPP 664 P PPPP Sbjct: 329 SPPPPPP 335 Score = 35.9 bits (79), Expect = 1.8 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 SPPP PP PPP PP PPP Sbjct: 329 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 388 Query: 687 KXPXPPPP 664 P PPPP Sbjct: 389 SPPPPPPP 396 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 35.9 bits (79), Expect = 1.8 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 SPPP PP PPP PP PPP Sbjct: 443 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 502 Query: 687 KXPXPPPP 664 P PPPP Sbjct: 503 SPPPPPPP 510 Score = 35.5 bits (78), Expect = 2.4 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 SPPP P PPPP PP PPP Sbjct: 211 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 270 Query: 687 KXPXPPPP 664 P PPPP Sbjct: 271 PSPPPPPP 278 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 260 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 240 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 273 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 245 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 278 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 260 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 276 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 309 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 292 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 325 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 330 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 309 PPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 317 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 326 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 333 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 366 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 361 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 370 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 401 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 377 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 410 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 415 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 440 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 471 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 447 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 480 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 475 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 484 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 491 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 524 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 522 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 555 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 256 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 289 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PP PPP PP PPP Sbjct: 272 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 304 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 307 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 296 SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 302 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPP 335 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PP PPP PP PPP Sbjct: 373 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 405 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 408 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 418 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 389 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 423 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 402 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 434 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 407 SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 430 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 463 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 471 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PP PPP PP PPP Sbjct: 487 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 519 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 522 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 499 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 532 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 503 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 535 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 504 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 537 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 511 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 516 SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 548 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 521 SPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 526 SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPP-PPPGXXXXXPXXPPPXP 765 PPPP PPP PPP P PPP P Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPP-PPPGXXXXXPXXPPPXP 765 PPPP PPP PPP P PPP P Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 354 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPP-PPPGXXXXXPXXPPPXP 765 PPPP PPP PPP P PPP P Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPP-PPPGXXXXXPXXPPPXP 765 PPPP PPP PPP P PPP P Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 452 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPP-PPPGXXXXXPXXPPPXP 765 PPPP PPP PPP P PPP P Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 301 SPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 333 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 262 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 211 PPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPP 244 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNP 269 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPP 271 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SP P PPPPPP PP PPP Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 254 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 224 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 38.3 bits (85), Expect = 0.34 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 587 PPPPPP--GASSIPPPPPPPGASSVPPPPPPP 616 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXX--PXXPPPXP 765 PPP G PPPPPPG P PPP P Sbjct: 598 PPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPP 632 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 866 PPPPXXXXG--GXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G G PPPPPP P PPP Sbjct: 612 PPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPP 645 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G PPPPPP PP PPP Sbjct: 586 APPPPPPGASSI--PPPPPPPGASSVPPPPPPP 616 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 866 PPPPXXXX--GGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 613 PPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPP 646 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPPG P PPP P Sbjct: 628 PPPPPPPGMPGMPPPPPPPG----MPGMPPPPP 656 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -1 Query: 864 PPPXXXGGXG----XXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 611 PPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPP 646 >UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 1115 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 565 PPPLPQNLSGAPPPPPPPPPMLGGPPPPPPPP 596 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 563 PPPPPLPQNLSGAPPPPPPPPPMLGGPPPPPPPP 596 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 562 PPPPPPLPQNLSGAPPPPPPPPPMLGGPPPPPPP 595 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 475 PPPPPGKNAPPPPPPPPPPPPHGKKAPPPPPPPP 508 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 472 PPPPPPPPGKNAPPPPPPPPPPPPHGKKAPPPPP 505 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 474 PPPPPPGKNAPPPPPPPPPPPPHGKKAPPPPPPP 507 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 473 PPPPPPPGKNAPPPPPPPPPPPPHGKKAPPPPPP 506 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PP P Sbjct: 471 PPPPPPPPPGKNAPPPPPPPPPPPPHGKKAPPPP 504 >UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: Formin A - Trypanosoma cruzi strain CL Brener Length = 1178 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 524 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP 561 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 540 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP 577 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 556 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP 593 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 572 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP 609 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 588 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP 625 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 604 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP 641 Score = 38.3 bits (85), Expect = 0.34 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 620 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP 657 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG PPP P Sbjct: 638 PPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPP 671 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPP GG PPPPPPG P PP Sbjct: 488 PPPPPPPGGKLPPPPPPPPGGKLPPPPPPP 517 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPPG PPP P Sbjct: 530 PPPPPPGGKGAPPPPPPPPGKLGPGGGPPPPPP 562 Score = 37.1 bits (82), Expect = 0.79 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXX----PPPXP 765 PPPP GG + PPPPPPG P PPP P Sbjct: 499 PPPPPPPPGG-KLPPPPPPPGKAPPPPPGGKLPPPPPP 535 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP--GXXXXXPXXPPPXP 765 PPPP G PPPPP G P PPP P Sbjct: 530 PPPPPPGGKGAPPPPPPPPGKLGPGGGPPPPPPPPP 565 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXP---PPXP 765 PPPP G PPPPP G P P PP P Sbjct: 488 PPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPP 524 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP GG PPPPPP PP PPP Sbjct: 521 PPPPPGGK---LPPPPPPGGKGAPPPPPPPP 548 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 647 PPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPP 678 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPPG P PPP Sbjct: 646 PPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPP 677 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG PPP P Sbjct: 632 PPPPPPMKAGPP--PPPPPPGVPRPPGGPPPPPP 663 Score = 36.3 bits (80), Expect = 1.4 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP PPPPPP PP PPP GG Sbjct: 606 PPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGG-------- 657 Query: 684 XPXPPPPXXG 655 P PPPP G Sbjct: 658 -PPPPPPPPG 666 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 606 PPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPP 637 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPPG PP P Sbjct: 662 PPPPGSKAGGP---PPPPPPGAPQPPGGSAPPPP 692 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P P P Sbjct: 658 PPPPPPPPGSKAGGPPPPPPPGAPQPPGGSAPPP 691 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 605 PPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPP 636 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP-PPPPPGXXXXXPXXPPPXP 765 PPPP + P PPPPP P PPP P Sbjct: 603 PPPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPP 637 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 644 PPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPP 677 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEP 75 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP E PPPPPP P PPP P Sbjct: 1950 PPPPPPPPPPTED-PPPPPPPPPAEAPPPPPPTP 1982 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEP 77 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQP 79 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP P PPP Sbjct: 52 SPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 38.3 bits (85), Expect = 0.34 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPP PG P PPP Sbjct: 984 PPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPP 1015 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP-PGXXXXXPXXPPP 771 PPPP G PPPPP PG P PPP Sbjct: 998 PPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPP 1030 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 981 PPPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPP 1014 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPP PP PPP Sbjct: 984 PPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPP 1015 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 996 PPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPP 1029 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP GG PPPP PG P PP P Sbjct: 1014 PPPLPGFSGGAPPPPPPPMPGAPIPPPPGAPPLP 1047 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP P PPP Sbjct: 1010 PPPPPPPLPGFSGGAPPPPPPPMPGAPIPPPP 1041 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPP-PXXXXXXPPXXPPP 769 PPP G PPPPP P PP PPP Sbjct: 999 PPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPP 1031 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP P Sbjct: 1013 PPPPLPGFSGGAPPPPPPPMPGAPIPPPPGAP 1044 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 38.3 bits (85), Expect = 0.34 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 876 FFFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 F SPPP PPPPPP PP PPP Sbjct: 52 FMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 878 FFFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 F PPPP PPPPPP P PPP Sbjct: 52 FMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 870 FSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 FS P PPPPPP PP PPP Sbjct: 46 FSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPP 79 >UniRef50_UPI0000F2E28C Cluster: PREDICTED: similar to high-mobility group protein 2-like 1,; n=1; Monodelphis domestica|Rep: PREDICTED: similar to high-mobility group protein 2-like 1, - Monodelphis domestica Length = 627 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 372 PPPTSTPFPGAVPPPPPPPPLPPPPPPPPPPP 403 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP PPPPPP PP PPP Sbjct: 370 APPPPTSTPFPGAVPPPPPPPPLPPPPPPPPPP 402 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 371 PPPPTSTPFPGAVPPPPPPPPLPPPPPPPPPPP 403 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPP P PPP Sbjct: 372 PPPTSTPFPGAVPPPPPPPPLPPPPPPPPPPP 403 >UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 protein; n=2; Danio rerio|Rep: PREDICTED: similar to LOC495114 protein - Danio rerio Length = 904 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 306 PPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPP 343 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 322 PPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPP 355 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 305 PPPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPP 338 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP---PPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPPG PPP P Sbjct: 321 PPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPP 357 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 338 PPPPPPGFAGLASPPPPPPPPGGLSIP--PPP 367 >UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 1167 Score = 37.9 bits (84), Expect = 0.45 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 655 PPPPSMGAPGVPPPPPPPPSGFGPAPP--PPP 684 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G + PPPPP P PPP P Sbjct: 641 PPPPPLPMGEQGAPPPPPSMGAPGVPPPPPPPP 673 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP G P PPP Sbjct: 655 PPPPSMGAPGVPPPPPPPPSGFGPAPP--PPP 684 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP PPPPPP P PP Sbjct: 654 PPPPPSMGAPGVPPPPPPPPSGFGPAPPPPP 684 >UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucleopolyhedrovirus|Rep: 1629capsid - Hyphantria cunea nuclear polyhedrosis virus (HcNPV) Length = 539 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 240 PPPPTPPPPPPNMPPPPPPPPNMPPPPPPPPPPP 273 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 37.9 bits (84), Expect = 0.45 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP---PGXXXXXPXXPPPXP 765 PPPP G PPPPP PG P PPP P Sbjct: 593 PPPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPP 629 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 608 PPPPPPLPGQKAGAPPPPPPPPPPGQKGIPPPPP 641 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP-GXXXXXPXXPPPXP 765 PPPP G + PPPPPP P PPP P Sbjct: 566 PPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLP 600 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP-PGXXXXXPXXPPP 771 PPPP G PPPPP PG P PPP Sbjct: 580 PPPPPPLPGQKAGPPPPPPLPGQKTGPPPPPPP 612 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G + PPPPPP P PPP P Sbjct: 547 PPPPPPLPGQHKQTPPPPPP------PPPPPPLP 574 Score = 35.9 bits (79), Expect = 1.8 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G PPPP P PP PPP G +K Sbjct: 582 PPPPLPGQKAGPPPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPG-------QK 634 Query: 684 XPXPPPPXXGG 652 PPPP GG Sbjct: 635 GIPPPPPTFGG 645 >UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1373 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 1293 PPPPMPSAGAPGGPPPPPPPPPPGMGAPPPPPMP 1326 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP PPP Sbjct: 1292 PPPPPMPSAGAPGGPPPPPPPPPPGMGAPPPP 1323 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -1 Query: 864 PPPXXXGGX--GXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PP Sbjct: 1294 PPPMPSAGAPGGPPPPPPPPPPGMGAPPPPPMPP 1327 >UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 1481 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 1396 PPPPPPPAFSAAAPPPPPPPPPVGGAPGGPPPPP 1429 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPP G P PPP Sbjct: 1399 PPPPAFSAAAPPPPPPPPPVGGAPGGPPPPPP 1430 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP PPPPPP P PPP Sbjct: 1395 APPPPPPPAFSAAAPPPPPPPPPVGGAPGGPPP 1427 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP P PPP Sbjct: 1399 PPPPAFSAAAPPPPPPPPPVGGAPGGPPPPPP 1430 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 37.9 bits (84), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPP P PPP P Sbjct: 574 PPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPP 607 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPPG P PPP P Sbjct: 576 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPP 609 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPP 784 PPP G G PPPPPP PP Sbjct: 590 PPPPPPGTDGPVPPPPPPPPPPPGGPP 616 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP G E P PP PG P PPP P Sbjct: 562 PPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPP 595 >UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein; n=1; Yarrowia lipolytica|Rep: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein - Yarrowia lipolytica (Candida lipolytica) Length = 659 Score = 31.9 bits (69), Expect(3) = 0.51 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 825 PPPPPPXXXXXXPPXXPPP 769 PPPPPP PP PPP Sbjct: 6 PPPPPPPPGFGGPPPPPPP 24 Score = 21.8 bits (44), Expect(3) = 0.51 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 681 PXPPPPXXGG 652 P PPPP GG Sbjct: 18 PPPPPPPGGG 27 Score = 21.4 bits (43), Expect(3) = 0.51 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 675 PPPPXXGGXF 646 PPPP GG F Sbjct: 19 PPPPPPGGGF 28 >UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1331 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPP PP PPP Sbjct: 848 PPPPPLPGMGVPPPPPPPLTHTGPAPPPPPPP 879 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 849 PPPPLPGMG----VPPPPPPPLTHTGPAPPPPPP 878 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 787 PPPPPPLPGVCAIPPPPPLPG--ASLPPPPPPLP 818 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 823 PPPPPPLPGMGAPPPPPPLPG--LSAPPPPPPLP 854 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP G PPPPPP PP PPP Sbjct: 835 PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPP 865 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 PPP G G PPPPPP PP PP Sbjct: 824 PPPPPLPGMGA--PPPPPPLPGLSAPPPPPP 852 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP G PPPP PG P PP Sbjct: 835 PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPP 865 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP P PPP Sbjct: 847 PPPPPPLPGMGVPPPPPPPLTHTGPAPPPPPP 878 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP P P PPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 >UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n=2; Danio rerio|Rep: UPI00015A5D5E UniRef100 entry - Danio rerio Length = 1093 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPP PP PPP Sbjct: 921 PPPPPLPGMGVPPPPPPPLTHTGPAPPPPPPP 952 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 922 PPPPLPGMG----VPPPPPPPLTHTGPAPPPPPP 951 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 860 PPPPPPLPGVCAIPPPPPLPG--ASLPPPPPPLP 891 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 896 PPPPPPLPGMGAPPPPPPLPG--LSAPPPPPPLP 927 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP G PPPPPP PP PPP Sbjct: 908 PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPP 938 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 PPP G G PPPPPP PP PP Sbjct: 897 PPPPPLPGMGA--PPPPPPLPGLSAPPPPPP 925 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP G PPPP PG P PP Sbjct: 908 PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPP 938 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP P PPP Sbjct: 920 PPPPPPLPGMGVPPPPPPPLTHTGPAPPPPPP 951 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 >UniRef50_A1SEF2 Cluster: Putative uncharacterized protein; n=1; Nocardioides sp. JS614|Rep: Putative uncharacterized protein - Nocardioides sp. (strain BAA-499 / JS614) Length = 282 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP G P PPP P Sbjct: 13 PPPPLPPPSGDGYGGPPPPTGGYGENPPPPPPAP 46 >UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: F24O1.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 70 Score = 37.5 bits (83), Expect = 0.60 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 875 FFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 F PPPP E PPPPPPG P P P P Sbjct: 13 FHHPPPPRPPP--PEPRPPPPPPGPQPPPPPPPRPDP 47 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 876 FFFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 F SPP PPPPPP PP PPP Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 870 FSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 FS P G P PPPP PP PPP Sbjct: 362 FSSYPIDCASFGCSPPSPPPPPPPPPPPPPPPPP 395 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 >UniRef50_Q9FLQ6 Cluster: Similarity to unknown protein; n=2; Arabidopsis thaliana|Rep: Similarity to unknown protein - Arabidopsis thaliana (Mouse-ear cress) Length = 832 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 27 PPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 41 PPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPP 74 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 42 PPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP 75 >UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; Eukaryota|Rep: Putative pherophorin-dz1 protein - Oryza sativa subsp. japonica (Rice) Length = 342 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 95 PPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPP 128 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPP 274 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 247 PPPPPPPP--PPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 243 PPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 244 PPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 252 PPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLP 285 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 253 PPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 >UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os03g0308700 protein - Oryza sativa subsp. japonica (Rice) Length = 464 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 279 PPPPPPSPPHATPPPPPPPPPREMVAPPPPPPPP 312 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 265 PPPSTPPRWTRSPTPPPPPPSPPHATPPPPPPPP 298 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP---GXXXXXPXXPPPXP 765 PPPP PPPPPP G P PPP P Sbjct: 292 PPPPPPPPREMVAPPPPPPPPYYGQPTLAPPPPPPPP 328 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 291 PPPPPPPPPREMVAPPPPPPPPYYGQPTLAPPPP 324 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P P P Sbjct: 307 PPPPPPYYGQPTLAPPPPPPPPYCGHPTLAPLPP 340 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -2 Query: 878 FFFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 F+ PPP PPPPPP P PPP P Sbjct: 11 FWRVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPPG P PPP P Sbjct: 536 PPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSP 569 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPP P P P P Sbjct: 548 PPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPP 581 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPP PP PP PPP Sbjct: 535 SPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPP 567 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PP PPP P PPP P Sbjct: 547 PPPPPSPPPGSAARPPSPPP-PSPPPPSPPPPSP 579 Score = 33.5 bits (73), Expect = 9.8 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPP-PPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXX 691 SPPP PPP PPP PP PPP G Sbjct: 506 SPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSP--PPGSAARPPS 563 Query: 690 KKXPXPPPP 664 P PPPP Sbjct: 564 PPPPSPPPP 572 >UniRef50_O48682 Cluster: F3I6.8 protein; n=2; Arabidopsis thaliana|Rep: F3I6.8 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 820 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 241 PPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 274 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 240 PPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 273 >UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 444 Score = 37.5 bits (83), Expect = 0.60 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 772 GGGXXGXXLSXPGGGGGGXXSXPPXXXXGGGG 867 GGG G PGGG GG PP GGGG Sbjct: 150 GGGGGGALARPPGGGRGGALGRPPGGGGGGGG 181 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 772 GGGXXGXXLSXPGGGGGGXXSXPPXXXXGGGG 867 GGG G S P G GGG + PP GGGG Sbjct: 110 GGGGGGGPPSLPPGAGGGGGARPPAPGGGGGG 141 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 766 GXGGGXXGXXLSXPGGGGGGXXSXPPXXXXGGGG 867 G GGG G + GGGGGG P GGGG Sbjct: 174 GGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGG 207 Score = 35.1 bits (77), Expect = 3.2 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = +2 Query: 656 PXXGGGGXGXFFXXXXXXPPPXTXXXXXXXXXXXXXXXGGGXXGGXXXXXXGGGGGGSXX 835 P GGGG G PP GGG GG GGGGGG Sbjct: 108 PPGGGGGGG----------PPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGAL 157 Query: 836 PXPPXXXGGG 865 PP GG Sbjct: 158 ARPPGGGRGG 167 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 766 GXGGGXXGXXLSXPGGGGGGXXSXPPXXXXGGGG 867 G GGG + GGGGG PP GGGG Sbjct: 322 GGGGGEIAGTVDLRGGGGGAGGVFPPTPDLGGGG 355 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP PPPPPP PP PPP Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 >UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; Basidiomycota|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 464 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PP P Sbjct: 309 PPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPP 342 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 310 PPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPP 343 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PP PP P PPP P Sbjct: 279 PPPPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPP 312 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG PPP P Sbjct: 1088 PPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPP 1121 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP PP PPP Sbjct: 1102 PPPPPPGAIGLTAPPPPPP------PPPPPPP 1127 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 1089 PPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPP 1122 >UniRef50_A6QT05 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 604 Score = 37.5 bits (83), Expect = 0.60 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 879 IFFFSPPPXXXGGXGXXXPPPPP-PXXXXXXPPXXPPP 769 +F PPP G G PPPPP P PP PPP Sbjct: 481 MFIPPPPPRPPGYHGAWPPPPPPLPQHSSTTPPFPPPP 518 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -2 Query: 872 FFPPPPXXXXGGXEXXPPPPP--PGXXXXXPXXPPPXP 765 F PPPP G PPPPP P P PPP P Sbjct: 482 FIPPPPPRPPGYHGAWPPPPPPLPQHSSTTPPFPPPPP 519 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPP-PPGXXXXXPXXPPPXP 765 PP GG PPPP PPG P PPP P Sbjct: 472 PPTVPGPGGMFIPPPPPRPPGYHGAWPPPPPPLP 505 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP PPPPPP PP PPP Sbjct: 8 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXPXXXXXXXFFFFFF 726 PPPP PPPPPP P PP F FF Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIPLFLRFF 74 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP P PPP P Sbjct: 368 PPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 401 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPG PPP P Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPP 400 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP GG PPPPPP P P P Sbjct: 382 PPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPP 414 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 383 PPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLP 416 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 359 PPPP-----GRGGPPPPPPPATGRSGPLPPPP 385 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPP 283 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSP 299 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPPPP P PPP P Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 260 PPPPPPPP---PPPPPPPPPSPPPPPPPPPPPPP 290 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SP P PPPPPP PP PPP Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 259 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 37.5 bits (83), Expect = 0.60 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 >UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous 1; n=1; Monodelphis domestica|Rep: PREDICTED: similar to diaphanous 1 - Monodelphis domestica Length = 1186 Score = 37.1 bits (82), Expect = 0.79 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 1/72 (1%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP G PPPPPP PP P P + G G Sbjct: 596 PPPPPLPGSISIPPPPPPPPPLPVLPP--PSPLPLPGSTGIPPPPPLLGGPGIPPPLPGM 653 Query: 684 -XPXPPPPXXGG 652 P PPPP GG Sbjct: 654 CLPPPPPPAFGG 665 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP G PPPP PG P PPP P Sbjct: 584 PPAPPLPSGINVPPPPPLPGSISIPPPPPPPPP 616 >UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa0079B05.10; n=4; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0079B05.10 - Oryza sativa (Rice) Length = 1269 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP PG P PPP P Sbjct: 637 PPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPP 670 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 750 PPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPP 783 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 605 PPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPP 638 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 606 PPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPP 639 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP-GXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 607 PPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPP 641 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 623 PPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAP 656 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 590 PPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPP 623 >UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar to human diaphanous homolog 1 (Drosophila) (DIAPH1),; n=4; Eutheria|Rep: Testis cDNA clone: QtsA-11950, similar to human diaphanous homolog 1 (Drosophila) (DIAPH1), - Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) Length = 504 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPP PG P PPP P Sbjct: 2 PPPPPPLPGGPGIPPPPPFPG----GPGIPPPPP 31 >UniRef50_Q9N3F7 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 315 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 770 GGGXXGGXXXXXXGGGGGGSXXPXPPXXXGGGEKK 874 GGG GG GGG G P PP GGG ++ Sbjct: 191 GGGGMGGGGGSGGSGGGSGRFPPPPPPYGGGGRRR 225 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 766 GXGGGXXGXXLSXPGGGGGGXXSXPPXXXXGGGGKKK 876 G GGG G G GGG PP GGGG+++ Sbjct: 189 GGGGGGMGGGGGSGGSGGGSGRFPPPPPPYGGGGRRR 225 >UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Diaphanous - Aedes aegypti (Yellowfever mosquito) Length = 1014 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 432 PPPPQMP--GMGPPPPPPPPGSGGGMPPPPPP 461 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 442 PPPPPPPPGSGGGMPPPPPPPMMPGVP-MPPPMP 474 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 PPP G G PPPPP PP PP Sbjct: 432 PPPPQMPGMGPPPPPPPPGSGGGMPPPPPPP 462 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 419 PPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPP 452 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 420 PPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPP 453 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 431 PPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCP 464 >UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 404 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP GG PPPPPP P PP P Sbjct: 338 PPPPPPPGGAGPPPPPPPPPPGLPAPPPPPGLP 370 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 339 PPPPPPGGAGPPPPPPPPPPG----LPAPPPP 366 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG G PPPPPP PP PPP Sbjct: 339 PPPPPPGGAGPP-PPPPPPPPGLPAPP--PPP 367 >UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 2195 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP GG PPPPPP P PP P Sbjct: 949 PPPPPPPGGAGPPPPPPPPPPGLPAPPPPPGLP 981 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPPG P PPP Sbjct: 950 PPPPPPGGAGPPPPPPPPPPG----LPAPPPP 977 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG G PPPPPP PP PPP Sbjct: 950 PPPPPPGGAGPP-PPPPPPPPGLPAPP--PPP 978 >UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 205 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 105 PPPPPPPPTTVVPPPPPPPPPTHTTHPHPPPPPP 138 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP E PPPPPP P PPP P Sbjct: 139 PPPPASSTKSAEAPPPPPPP------PPPPPPPP 166 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 107 PPPPPPTTVVPPPPPPPPPTHTTHPHPPPPPPPP 140 >UniRef50_A0JLT2 Cluster: Mediator of RNA polymerase II transcription subunit 19; n=31; Euteleostomi|Rep: Mediator of RNA polymerase II transcription subunit 19 - Homo sapiens (Human) Length = 244 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G G PPPPPP P PPP Sbjct: 15 PPPPTALGFGPGKPPPPPPPPAGGGPGTAPPP 46 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PP Sbjct: 14 PPPPPTALGFGPGKPPPPPPPPAGGGPGTAPP 45 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP PPP Sbjct: 15 PPPPTALGFGPGKPPPPPPPPAGGGPGTAPPP 46 >UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=53; Actinobacteria (class)|Rep: Translation initiation factor IF-2 - Streptomyces avermitilis Length = 1046 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 766 GXGGGXXGXXLSXPGGGGGGXXSXPPXXXXGGGGK 870 G GGG PGGGGGG P GGGG+ Sbjct: 356 GGGGGGFAGRPGGPGGGGGGFAGRPGGPGGGGGGR 390 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 766 GXGGGXXGXX--LSXPGGGGGGXXSXPPXXXXGGGG 867 G GGG G PGGGGGG P GGGG Sbjct: 340 GGGGGRPGGGGFAGRPGGGGGGFAGRPGGPGGGGGG 375 >UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2; Mus musculus|Rep: FH1/FH2 domain-containing protein 1 - Mus musculus (Mouse) Length = 1197 Score = 37.1 bits (82), Expect = 0.79 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPP--PPGXXXXXPXXPPPXP 765 PPPP G PPPP PP P PPP P Sbjct: 591 PPPPPPITGSCPPPPPPPLPPPATGSCPPPPPPPPP 626 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPP PP PP PPP Sbjct: 593 PPPPITGSCPPPPPPPLPPPATGSCPPPPPPP 624 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPP--PPGXXXXXPXXPPPXP 765 PPPP G PPPP PP P PPP P Sbjct: 590 PPPPPPPITGSCPPPPPPPLPPPATGSCPPPPPPPP 625 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 604 PPPPPLPPPATGSCPPPPPPPPPPIIGSCPPPPP 637 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 842 GGXEXXPPPPPPGXXXXXPXXPPPXP 765 GG PPPPPP P PPP P Sbjct: 585 GGPPPPPPPPPPITGSCPPPPPPPLP 610 >UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Euteleostomi|Rep: Protein diaphanous homolog 1 - Homo sapiens (Human) Length = 1248 Score = 37.1 bits (82), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP P PPP P Sbjct: 667 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLP 700 Score = 37.1 bits (82), Expect = 0.79 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPP PG P PPP P Sbjct: 693 PPPPPPLPGGPGIPPPPPFPG----GPGIPPPPP 722 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P PPPP PG P PPP P Sbjct: 574 PPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPP 607 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPP G P PPP P Sbjct: 606 PPPPPPLPGGTAISPPPPLSGDATIPP--PPPLP 637 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPP P PPP P Sbjct: 655 PPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLP 687 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP-PGXXXXXPXXPPPXP 765 PPPP G PPPPP PG P PPP P Sbjct: 680 PPPPPPLPGEAGMPPPPPPLPGGPGIPP--PPPFP 712 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 64 PPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPP 97 >UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit - Strongylocentrotus purpuratus Length = 1729 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 1648 PPPPPPPFGAA---PPPPPPPCGAPPPPPPPPPP 1678 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP G PPPPPP PP PPP Sbjct: 1648 PPPPPPPFGAAPPPPPPPCGAPPPPPPPPPP 1678 >UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=3; Danio rerio|Rep: Wiskott-Aldrich syndrome protein (WASp). - Danio rerio Length = 490 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPP P PPP Sbjct: 366 PPPLPEPSGGGPPPPPPPPAAPPPPPAAPPP 396 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP G PPPPPP PP PPP Sbjct: 366 PPPLPEPSGGGPPPPPPPPAAPPPPPAAPPP 396 >UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleostomi|Rep: Wiskott-Aldrich syndrome - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 479 Score = 36.7 bits (81), Expect = 1.0 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP PPPPPP PP PP G Sbjct: 335 PPPPAPHCNRSGPPPPPPPSQSHKPPP--PPMGACAPPPPPPPPPPPSSSGNFSSSPVSS 392 Query: 684 XPXPPPPXXGG 652 P PPPP GG Sbjct: 393 APPPPPPSGGG 403 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPP P P PPP Sbjct: 321 PPPPSRSPGPPHRGPPPPAPHCNRSGPPPPPP 352 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPP P PP PPP Sbjct: 322 PPPSRSPGPPHRGPPPPAPHCNRSGPPPPPPP 353 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPP G P PPP P Sbjct: 347 PPPPPPPSQSHK--PPPPPMGACAPPPPPPPPPP 378 >UniRef50_Q6P120 Cluster: Enah/Vasp-like b; n=2; Danio rerio|Rep: Enah/Vasp-like b - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 376 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPP-PPXXXXXXPPXXPPP 769 PPP GG PPPP PP PP PPP Sbjct: 179 PPPLSLGGPCPPPPPPPVPPLPSAGAPPPPPPP 211 >UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1140 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 545 PPPPLPCFAGLAP-PPPPLPGAMMPPPPPPPPPP 577 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 +PPP G PPPPPP PP PP Sbjct: 556 APPPPPLPGAMMPPPPPPPPPPGGPPPPGRPP 587 >UniRef50_Q4RLP1 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 826 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PP PPP P PPP P Sbjct: 333 PPPPLPGSLGVAPPPPAPPPPFMGSGPPPPPPVP 366 >UniRef50_Q4KT78 Cluster: ORF1629; n=2; Nucleopolyhedrovirus|Rep: ORF1629 - Chrysodeixis chalcites nucleopolyhedrovirus Length = 417 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 217 PPPPSLPPMSSIPPPPPPPPMPLTSIPPPPPPPP 250 >UniRef50_Q9FF14 Cluster: Similarity to unknown protein; n=3; Arabidopsis thaliana|Rep: Similarity to unknown protein - Arabidopsis thaliana (Mouse-ear cress) Length = 464 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 18 PPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPP 49 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPP 49 >UniRef50_Q6H899 Cluster: Nuclear protein ZAP-like; n=6; Magnoliophyta|Rep: Nuclear protein ZAP-like - Oryza sativa subsp. japonica (Rice) Length = 753 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 878 FFFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 F F PPPP PPPPPP PPP P Sbjct: 22 FPFCPPPPHPFPYDLHPPPPPPPPEYHAPFHPPPPPPP 59 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 40 PPPPPPEYHAPFHPPPPPPPPPEYHVPFHPPP 71 >UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole genome shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome chr1 scaffold_135, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 673 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 76 SPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPPP 108 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PP P Sbjct: 89 PPPPPPPPSSGSGPPKPPPPSHSNSSPPPPPTSP 122 >UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23; n=5; Bilateria|Rep: Putative uncharacterized protein grl-23 - Caenorhabditis elegans Length = 385 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 770 GGGXXGGXXXXXXGGGGGGSXXPXPPXXXGGG 865 GGG GG GG GGG P PP GGG Sbjct: 33 GGGCGGGGGCGGGGGCGGGCAPPPPPPACGGG 64 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 770 GGGXXGGXXXXXXGGG-GGGSXXPXPPXXXGGG 865 GGG GG GGG GGG P PP GGG Sbjct: 89 GGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGG 121 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 1536 PPPSSGSSAPPPPPPPPPPPPPPPPPPPSPPP 1567 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 1166 PSPPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPP 1199 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP G PPPPPP PP PPP Sbjct: 1533 PPHPPPSSGSSAPPPPPPPPPPPPPPPPPPP 1563 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 867 SPP-PXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPP P G PPPPPP PP PPP Sbjct: 1167 SPPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPPP 1200 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXPXXXXXXXFF 738 PP P G PPPPPP P PP P F+ Sbjct: 1533 PPHPPPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPPSPFY 1575 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP G PPPPPP P PPP P Sbjct: 1168 PPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPPP 1200 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 500 PPPPPPPSKSSGPPPPPPPPPKSSGPPPPPPP 531 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 499 PPPPPPPPSKSSGPPPPPPPPPKSSGPPPPPP 530 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 500 PPPPPPPSKSSGPPPPPPPPPKSSGPPPPPPP 531 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 498 PPPPPPPPPSKSSGPPPPPPPPPKSSGPPPPPPP 531 >UniRef50_Q54BJ4 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 792 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 358 PPPPPSLSSYGDLPPPPPPPSFTSFGDFPPPPPP 391 >UniRef50_A2DXB4 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1322 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 715 SPPPPAPISLPPGVPPPPPPPEGIPLPPGVPPP 747 >UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_73, whole genome shotgun sequence - Paramecium tetraurelia Length = 442 Score = 36.7 bits (81), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPP PPG P PP P Sbjct: 79 PPPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNP 112 >UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c; n=1; Candida glabrata|Rep: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1039 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPP P PPP Sbjct: 667 PPPPSDHSGPHGAPPPPPPPTHTAHPPPPPP 697 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP G PPPPPP P PP Sbjct: 667 PPPPSDHSGPHGAPPPPPPPTHTAHPPPPPP 697 >UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 664 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 P PP GG PPPPPPG P PPP Sbjct: 546 PGPPPAMSGGPP--PPPPPPGDFGVTPGPPPP 575 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = -2 Query: 866 PPPPXXXX------GGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPPG PPP P Sbjct: 488 PPPPASSRPVPGVPGGVPPPPPPPPPGPGPAAAGGPPPPP 527 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPG PPP P Sbjct: 527 PPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPP 560 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P G PPPPPPG PP P Sbjct: 512 PPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPP 545 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 543 PPPPGPPPAMSGGPPPPPPPPGDFGVTPGPPPPP 576 >UniRef50_Q0UMH1 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 347 Score = 36.7 bits (81), Expect = 1.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 P PP PPPPPPG P PPP Sbjct: 123 PAPPPAPPSSTPSAPPPPPPGAVPPAPPPPPP 154 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PP Sbjct: 6 PPPPMPPMGRGAGGPPPPPPMPGMKAPGGKPP 37 >UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morphogenesis 1; n=37; Amniota|Rep: Disheveled-associated activator of morphogenesis 1 - Homo sapiens (Human) Length = 1078 Score = 36.7 bits (81), Expect = 1.0 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPP-PPGXXXXXPXXPP 774 PPPP GG PPPP PPG P PP Sbjct: 551 PPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPP 582 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PP Sbjct: 550 PPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPP 581 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP-PGXXXXXPXXPPP 771 PPPP G PPPPP P P PPP Sbjct: 550 PPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPP 582 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP GG PPPPP PP PPP Sbjct: 553 PPPPLPGGM--LPPPPPPLPPGGPPPPPGPPP 582 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 36.3 bits (80), Expect = 1.4 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 4/71 (5%) Frame = -1 Query: 864 PPPXXX----GGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXX 697 PPP GG PPPPPP PP PPP V GG Sbjct: 471 PPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPP------------PPSVFAGGQQQQ 518 Query: 696 XXKKXPXPPPP 664 P PPPP Sbjct: 519 PPPPPPPPPPP 529 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G P PPP P Sbjct: 489 PPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPPP 526 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXX--GGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP PPP P Sbjct: 470 PPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPP 505 >UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|Rep: Diaphanous homologue - Gallus gallus (Chicken) Length = 1253 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 623 PPPPPLPGGAAVIPPPPPLPGGAAVIP-PPPPLP 655 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 636 PPPPPLPGGAAVIPPPPPLPGGAAVIP-PPPPLP 668 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 649 PPPPPLPGGAAVIPPPPPLPGGAAVIP-PPPPLP 681 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP GG PPPP PG PPP P Sbjct: 688 PPPPLLPGGTVIPPPPPLPGGAAAVLPPPPPLP 720 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG P PP PG P P P Sbjct: 573 PPPPPPLPGGAAIPPAPPLPGGAAIPPAPPLP 604 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPP PG P PPP Sbjct: 662 PPPPPLPGGAAVIPPPPPLPGGAAVIP--PPP 691 >UniRef50_A0QHS8 Cluster: Putative uncharacterized protein; n=2; Mycobacterium avium|Rep: Putative uncharacterized protein - Mycobacterium avium (strain 104) Length = 111 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPG P P P P Sbjct: 78 PPPPLHGPPGPPHGFPPPPPGEAFPTPPPPSPRP 111 >UniRef50_A5BPY4 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 341 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 26 PPPPLPMMPLKGSVPPPPPPKNGAAPPPPPPPLP 59 >UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG06865; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG06865 - Caenorhabditis briggsae Length = 646 Score = 36.3 bits (80), Expect = 1.4 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 770 GGGXXGGXXXXXXGGGG-GGSXXPXPPXXXGGG 865 GGG GG GGGG GG P PP GGG Sbjct: 26 GGGGGGGCGGGCGGGGGCGGGCGPPPPPPCGGG 58 >UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG21491; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG21491 - Caenorhabditis briggsae Length = 429 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 PPP G PPPPPP PP PP Sbjct: 316 PPPPPSGAPPTGSPPPPPPQSGGSPPPGAPP 346 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 SPPP G G PPPP PP PP Sbjct: 303 SPPPRPSGAPGSPPPPPPSGAPPTGSPPPPPP 334 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP G PPPPP PP PP Sbjct: 314 SPPPPPPSGAPPTGSPPPPPPQSGGSPPPGAPP 346 >UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 603 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP--PPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPPG PPP P Sbjct: 393 PPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPPP 428 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 383 PPPPPPPP--PPPPPPPPPPAGKAPPPPIPPPPP 414 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 396 PPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPPPP 429 >UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 576 Score = 36.3 bits (80), Expect = 1.4 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 3/70 (4%) Frame = -1 Query: 864 PPPXXXGG---XGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXX 694 PPP GG G PPPPPP PPP G Sbjct: 369 PPPPPPGGLRPPGKAPPPPPPPPPMFAGKMKAPPPPPIKAPPPMPSLPGAAATKGLPIGN 428 Query: 693 XKKXPXPPPP 664 P PPPP Sbjct: 429 APPAPPPPPP 438 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +P P GG PPPPPP PP PPP Sbjct: 516 APAPPQKGGV---PPPPPPPPPPKAPPPKGPPP 545 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPP PPP P Sbjct: 372 PPPGGLRPPGKAPPPPPPPPPMFAGKMKAPPPPP 405 >UniRef50_Q23248 Cluster: Putative uncharacterized protein grl-21; n=2; Caenorhabditis|Rep: Putative uncharacterized protein grl-21 - Caenorhabditis elegans Length = 172 Score = 36.3 bits (80), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP 807 PPPP GG E PPPPPP Sbjct: 41 PPPPPPCGGGYEAPPPPPPP 60 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPPP P P Sbjct: 40 PPPPPPPCGGGYEAPPPPPPPSYAGGPSYAGP 71 >UniRef50_Q19479 Cluster: Putative uncharacterized protein inft-2; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein inft-2 - Caenorhabditis elegans Length = 1140 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP--GXXXXXPXXPPPXP 765 PPPP G PPPPPP G PPP P Sbjct: 489 PPPPMPSINGHAPNPPPPPPLLGIAPMSTNAPPPPP 524 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXG----GXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPP G P PPP P Sbjct: 521 PPPPMPGMAPLSTGAPTPPPPPPVGMANGGPPPPPPLP 558 >UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1254 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP GG PPP P G P PPP P Sbjct: 511 PPPPPPPGGSVPPPPPLPGGTCSSGPPPPPPPP 543 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPP P P PPP P Sbjct: 257 PPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPP 290 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 271 PPPPAPSAKGGAPPPPPPPP----PPPPPPPPPP 300 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 271 PPPPAPSAKGGAPPPPPPP--PPPPPPPPPPP 300 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 P P GG PPPPPP PP PP Sbjct: 274 PAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPP 305 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 283 PPPPPPPP--PPPPPPPPPPKGVPPPPRGPPPPP 314 >UniRef50_Q5AAF4 Cluster: Putative uncharacterized protein BNI1; n=1; Candida albicans|Rep: Putative uncharacterized protein BNI1 - Candida albicans (Yeast) Length = 1485 Score = 36.3 bits (80), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP PG P PPP P Sbjct: 873 PPPPVPEFIKSSAPPPPPLPGFITTTPPPPPPLP 906 >UniRef50_Q2H3D5 Cluster: Putative uncharacterized protein; n=3; Pezizomycotina|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 878 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 +PPPP PPPPP G PPP P Sbjct: 750 YPPPPSGKHASHGNYPPPPPSGNHASHGNYPPPPP 784 >UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 307 Score = 36.3 bits (80), Expect = 1.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 84 PPPPPPPPTSTQAPPPPPPPPAETTTQAPPPPPP 117 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 83 PPPPPPPPPTSTQAPPPPPPPPAETTTQAPPPPP 116 >UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eutheria|Rep: Protein diaphanous homolog 2 - Homo sapiens (Human) Length = 1101 Score = 36.3 bits (80), Expect = 1.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP--PGXXXXXPXXPPP 771 PPPP G PPPPP PG P PPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP G PPPPPP P PPP Sbjct: 578 PPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP G PPPPPP P PP Sbjct: 578 PPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP P PPP Sbjct: 565 PPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPP 596 >UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogeneous nuclear ribonucleoprotein K; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to Heterogeneous nuclear ribonucleoprotein K - Nasonia vitripennis Length = 445 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 766 GXGGGXXGXXLSXPGGGGGGXXSXPPXXXXGGG 864 G GGG G PGGG GG PP GGG Sbjct: 171 GGGGGGGGGPGGKPGGGFGGGRGGPPNAPPGGG 203 >UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 454 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 160 PPPAHPAAYGAP-PPPPPPASYAAPPPPPPPP 190 Score = 34.3 bits (75), Expect = 5.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP PPPPPP P PPP Sbjct: 159 PPPPAHPAAYGAPPPPPPPASYAAPPPPPPP 189 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 159 PPPPAHPAA--YGAPPPPPPPASYAAPPPPPPPP 190 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP PPPPPP P PP Sbjct: 171 PPPPPPPASYAAPPPPPPPPASYAAPPPAPP 201 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPP G PPPPPPG P PP Sbjct: 974 PPPPPPFPGMTPPPPPPPPGCGPPPPPLPP 1003 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PPP Sbjct: 964 PPPPPLPGMA---PPPPPPFPGMTPPPPPPPP 992 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 963 PPPPPPLPG---MAPPPPPPFPGMTPPPPPPP 991 >UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, inverted; n=1; Gallus gallus|Rep: PREDICTED: similar to formin, inverted - Gallus gallus Length = 1208 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPP P PPP P Sbjct: 443 PPPPLPGMGGI---PPPPPLSGMGGIPPPPPPLP 473 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 368 PPPPPPLPGMAVIPPPPPLPG-MAVIPPPPPPLP 400 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP PG P PPP P Sbjct: 393 PPPPPPLPGMGGIPPPPPLPGMGGIPP--PPPLP 424 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPP PG P PPP P Sbjct: 407 PPPPLPGMGG--IPPPPPLPGLGGIPP--PPPLP 436 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPP PG P PPP P Sbjct: 419 PPPPLPGLGG--IPPPPPLPGLAGIPP--PPPLP 448 >UniRef50_UPI00006A1088 Cluster: WAS/WASL interacting protein family member 2 (WIP-related protein) (WASP-interacting protein-related protein) (WIP- and CR16-homologous protein).; n=10; Tetrapoda|Rep: WAS/WASL interacting protein family member 2 (WIP-related protein) (WASP-interacting protein-related protein) (WIP- and CR16-homologous protein). - Xenopus tropicalis Length = 373 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 301 PPPPARDPPGRGAAPPPPPPIVRNGGRDAPPPPP 334 Score = 35.1 bits (77), Expect = 3.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP 807 PPPP GG + PPPPPP Sbjct: 317 PPPPIVRNGGRDAPPPPPPP 336 >UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative lectin protein precursor - Emiliania huxleyi virus 86 Length = 1994 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 206 PPPPSPFPPSPPPSPAPPPPSPLPPPPLPPPPSP 239 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPP PP PPP Sbjct: 696 SPPPPSPPSPPPPSPPPPPSPPPPSLPPSPPPP 728 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 35.9 bits (79), Expect = 1.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 FP PP PPPPPP P PPP P Sbjct: 202 FPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPP 236 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 218 PPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPP 249 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 219 PPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPP 237 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 216 PPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPP 249 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 217 PPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 2273 PPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPP 2304 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 2680 PPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSP 2713 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 219 PPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSP 252 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 226 PPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPP 259 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 2256 SPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPP 2288 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 2272 PPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPP 2305 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSP 2565 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 2544 SPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPP 2576 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 2692 SPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPP 2724 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 2741 SPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPP 2773 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPP--PPPPGXXXXXPXXPPPXP 765 PPPP PP PPPP P PPP P Sbjct: 221 PPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPP-PPGXXXXXPXXPPPXP 765 PPPP PPPP PP P PPP P Sbjct: 2703 PPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSP 2737 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPP-PPGXXXXXPXXPPPXP 765 PPPP PPPP PP P PPP P Sbjct: 2708 PPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2742 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 873 FFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 F SPPP PPPPPP P PPP Sbjct: 202 FPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPP 236 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSP 239 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 231 PPPPPPPSPPPPSPPPPPPPSPP---PPPPPPLP 261 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 1181 PPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLP 1214 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 2679 SPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPP 2711 Score = 33.5 bits (73), Expect = 9.8 Identities = 18/68 (26%), Positives = 18/68 (26%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 SPPP P PPPP PP PP Sbjct: 2716 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPS 2775 Query: 687 KXPXPPPP 664 P PPPP Sbjct: 2776 PPPSPPPP 2783 >UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; cellular organisms|Rep: RNP-1 like RNA-binding protein - Solibacter usitatus (strain Ellin6076) Length = 132 Score = 35.9 bits (79), Expect = 1.8 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +1 Query: 766 GXGGGXXGXXLSXPGGGGGGXXSXPPXXXXGGGGKKK 876 G GGG G PGGGGGG P GGGG ++ Sbjct: 95 GFGGGGGG---GRPGGGGGGGGRRPGGGGGGGGGNRR 128 >UniRef50_Q7F0U2 Cluster: OJ1116_C07.3 protein; n=4; Oryza sativa|Rep: OJ1116_C07.3 protein - Oryza sativa subsp. japonica (Rice) Length = 195 Score = 35.9 bits (79), Expect = 1.8 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 4/68 (5%) Frame = +2 Query: 656 PXXGGGGXGXFFXXXXXXPPPXTXXXXXXXXXXXXXXX----GGGXXGGXXXXXXGGGGG 823 P GGGG G PPP + GGG GG GGGGG Sbjct: 76 PSGGGGGGGGGTVMYTSPPPPYSGGGGGSSTGGGGIYYPPPTGGGGGGGGGWQQGGGGGG 135 Query: 824 GSXXPXPP 847 P PP Sbjct: 136 AYPTPPPP 143 >UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12; Magnoliophyta|Rep: H0211F06-OSIGBa0153M17.6 protein - Oryza sativa (Rice) Length = 1510 Score = 35.9 bits (79), Expect = 1.8 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP GG G PP PP PPP GG Sbjct: 1122 PPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGG 1181 Query: 684 XPXPPPPXXG 655 PPPP G Sbjct: 1182 VAPPPPPPRG 1191 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP G PPPPPPG P PP Sbjct: 1099 PPPPSIGAGAP---PPPPPPGGITGVPPPPP 1126 >UniRef50_Q5DGR5 Cluster: SJCHGC08168 protein; n=1; Schistosoma japonicum|Rep: SJCHGC08168 protein - Schistosoma japonicum (Blood fluke) Length = 134 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP-----PPPPPGXXXXXPXXPPPXP 765 PPPP G + P PPPPP P PPP P Sbjct: 60 PPPPSSIVGAKDTKPLLPPPPPPPPAFSLGAPPPPPPPP 98 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 869 FPPPPXXXXG-GXEXXPPPPPPGXXXXXPXXPPPXP 765 +PPPP G G P PPPP P PPP P Sbjct: 278 YPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPP 313 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 +P PP PPPPPP P PPP P Sbjct: 293 YPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPP 327 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXPPPPP--PGXXXXXPXXPPPXP 765 +PPPP PPPPP P P PPP P Sbjct: 248 YPPPPYPNPYPQPPYPPPPPPYPNPYPQPPYPPPPAP 284 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP + PPPPPP P PPP Sbjct: 365 PPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPP 396 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 353 PPPQQQQNKSAPPPPPPPPPPPPKGAPPPPPPPP 386 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 366 PPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPP 397 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP PP PP Sbjct: 371 PPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPP 402 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 366 PPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPP 397 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXP---PPXP 765 PPPP G PPPPPP P P PP P Sbjct: 368 PPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPP 404 >UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=58; Pneumocystis carinii|Rep: Protease-1 (PRT1) protein, putative - Pneumocystis carinii Length = 947 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP P P PPP P Sbjct: 789 PPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPP 822 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP PPPPP PP PPP Sbjct: 788 APPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPP 820 >UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 305 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 +PPP G PPPPPP PP PP Sbjct: 69 APPPRPPPPPGYGEPPPPPPPGYGEQPPPPPP 100 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP G + PPPPPPG P PP Sbjct: 83 PPPPPPPGYGEQ--PPPPPPGYAAEPPPPPP 111 >UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 580 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPPG P PP P Sbjct: 510 PPPPPPPPPG--TPPPPPPPGSPPDTPGPGPPHP 541 >UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 1648 Score = 35.9 bits (79), Expect = 1.8 Identities = 24/76 (31%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPP--XXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 PP G G PPPPPP PP PPP GG Sbjct: 975 PPQAPGFNGPPPPPPPPPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPGFGG------- 1027 Query: 687 KXPXPPPPXXGGXFFY 640 P PPPP G +Y Sbjct: 1028 PPPPPPPPPPPGMAWY 1043 >UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 429 Score = 35.9 bits (79), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PP Sbjct: 363 PPPPPASSGSPAPPPPPPPPPKTTMVPQPQPP 394 >UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; n=287; cellular organisms|Rep: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific - Mus musculus (Mouse) Length = 440 Score = 35.9 bits (79), Expect = 1.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP E PPPPPP P PPP P Sbjct: 70 PPPPQIEPDKFEEAPPPPPP---PPPPPPPPPPP 100 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGX--EXXPPPPPPGXXXXXPXXPPPXP 765 PPPP E PPPPPP P PPP P Sbjct: 38 PPPPKLEDPPPTVEEQPPPPPPPPPPPPPPPPPPPP 73 >UniRef50_UPI00015B55AC Cluster: PREDICTED: similar to GA10757-PA; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to GA10757-PA - Nasonia vitripennis Length = 1350 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPP G PPPPPPG P PP Sbjct: 1177 PPPSYLYGPPGSFPPPPPPGSFLPPPPPPP 1206 >UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV.; n=4; Xenopus tropicalis|Rep: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. - Xenopus tropicalis Length = 1182 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP PPP P Sbjct: 691 PPPPPFPGGG---PPPPPPPFPGYGSSAVPPPLP 721 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPP PG P PPP P Sbjct: 643 PPPPPLPGSSSVPPPPPLPGISSAPP--PPPLP 673 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 35.5 bits (78), Expect = 2.4 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -2 Query: 875 FFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXPXXXXXXXFFFFFF 726 F PPPP PPPPPP P PPP P +F F Sbjct: 303 FASPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPPAFEAREFIVYFPF 349 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 873 FFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 F SPPP PPPPPP PP PP Sbjct: 303 FASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 876 FFFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 + F+ PP PPPPPP PP PPP Sbjct: 301 YSFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 34.7 bits (76), Expect = 4.2 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -2 Query: 878 FFFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXPXXXXXXXFFFFF 729 + F PPP PPPPPP P PPP P F +F Sbjct: 301 YSFASPPPPPPPPPPPPPPPPPPP---PPPPPPPPPPPPAFEAREFIVYF 347 >UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae|Rep: Blr0521 protein - Bradyrhizobium japonicum Length = 745 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP PPPPPP PP PPP Sbjct: 82 APPPAAAPPRPAAPPPPPPPPAARPAPPPPPPP 114 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 83 PPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPP 115 Score = 34.3 bits (75), Expect = 5.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP + PPPPPP P PPP P Sbjct: 150 PPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPP 182 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPP 774 PPPP PPPPPP P PP Sbjct: 95 PPPPPPPPAARPAPPPPPPPPAAPKQPSPPP 125 >UniRef50_Q0DB93 Cluster: Os06g0590100 protein; n=11; Oryza sativa|Rep: Os06g0590100 protein - Oryza sativa subsp. japonica (Rice) Length = 1399 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 S P GG PPPPPP PP PPP Sbjct: 66 SSGPRLTGGGLLKSPPPPPPPPPPPPPPPPPPP 98 >UniRef50_A4RZ69 Cluster: Predicted protein; n=2; Ostreococcus|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 711 Score = 35.5 bits (78), Expect = 2.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 604 PPPPSAVQSTTRAIPPPPPPS-STSAPLPPPPPP 636 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 618 PPPPPPSSTSAPLPPPPPPPRAATTMVEVPPPPP 651 >UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Protease - Cryptosporidium hominis Length = 1569 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 1525 PPPSSSSPSPPPPPPPPPPPPSSSSPSPPPPPP 1557 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 1538 PPPPPPPPSSSSPSPPPPPP---PLPPPPPPPPP 1568 >UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1723 Score = 35.5 bits (78), Expect = 2.4 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = -2 Query: 866 PPPPXXXX------GGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 1012 PPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPPPPPP 1051 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +P GG PPPPPP PP PPP Sbjct: 1019 APVAPGFGGPPPPPPPPPPPGMPGMPPPPPPPP 1051 >UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 757 Score = 35.5 bits (78), Expect = 2.4 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = +2 Query: 653 PPXXGGGGXGXFFXXXXXXPPPXTXXXXXXXXXXXXXXXGGGXXGGXXXXXXGGGGGGSX 832 PP GGG G PP GGG GG G GGGG Sbjct: 364 PPEGGGGSDGAPGRGGGGGGPPG-GGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGG 422 Query: 833 XPXPPXXXGGGE 868 PP GG + Sbjct: 423 GGGPPEGGGGSD 434 >UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleostomi|Rep: Ran-binding protein 9 - Homo sapiens (Human) Length = 729 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 72 PPPPPPATAAPPPPPPPPPPPASAAAPASGPPAP 105 >UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)]; n=10; Eukaryota|Rep: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] - Sus scrofa (Pig) Length = 676 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 P P G PPPPPP PP PPP Sbjct: 644 PGPAPPGARPPPGPPPPPPGPSPPRPPPGPPP 675 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXP---PPXP 765 PPPP G P PPPPG P P PP P Sbjct: 382 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPP 418 Score = 34.3 bits (75), Expect = 5.6 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP--PPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPPG P PPP P Sbjct: 641 PPPPGPAPPGARPPPGPPPPPPG---PSPPRPPPGP 673 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 88 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 121 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 109 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 142 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 130 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 163 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 151 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 184 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 172 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 205 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 193 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 226 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 214 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 247 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 256 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 289 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 277 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 310 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 298 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 331 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 319 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 352 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 340 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 373 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 361 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 394 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 473 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 506 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 494 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 527 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 515 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 548 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 536 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 569 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 557 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 590 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 578 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 611 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 599 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 632 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G P PPPPG P P P Sbjct: 620 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 653 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 35.5 bits (78), Expect = 2.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPP---PGXXXXXPXXPPPXP 765 PPP G PPPPP PG P PPP P Sbjct: 480 PPPLPGSGTISPPPPPPPPPLPGTGAVSPPPPPPLP 515 Score = 35.5 bits (78), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPP P PPP P Sbjct: 496 PPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPP 529 Score = 33.9 bits (74), Expect = 7.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPP-----PXXXXXXPPXXPPP 769 PPP G G PPPPP P PP PPP Sbjct: 495 PPPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPP 531 Score = 33.5 bits (73), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP-----PGXXXXXPXXPPPXP 765 PPPP G PPPPP P P PPP P Sbjct: 494 PPPPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPPP 532 >UniRef50_UPI000023F6A5 Cluster: hypothetical protein FG10389.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG10389.1 - Gibberella zeae PH-1 Length = 1061 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 +PPPP G PPPP P P P P P Sbjct: 800 YPPPPPGPPRGLSTGPPPPGPPGPPPPPGPPGPPP 834 >UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF16309, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 283 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 150 PPPPTGVLDQSSTAPPPPPATGIGFPPPPPPPVP 183 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G G PPPPP PP PPP Sbjct: 163 APPPPPATGIGFPPPPPPPVPGGVSVPP--PPP 193 Score = 30.7 bits (66), Expect(2) = 8.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = -1 Query: 864 PPPXXXGGXGXXXP-PPPPPXXXXXXPPXXPPP 769 PPP G PPPPP PP PPP Sbjct: 149 PPPPPTGVLDQSSTAPPPPPATGIGFPPPPPPP 181 Score = 21.8 bits (44), Expect(2) = 8.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 681 PXPPPPXXGG 652 P PPPP GG Sbjct: 176 PPPPPPVPGG 185 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 35.1 bits (77), Expect = 3.2 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXK 688 SP P PP PPP PP PPP G Sbjct: 194 SPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPP 253 Query: 687 KXPXPPPP 664 P PPPP Sbjct: 254 PPPPPPPP 261 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP P P PPP P Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSP 230 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 93 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 125 >UniRef50_O86637 Cluster: Putative uncharacterized protein SCO5717; n=2; Streptomyces|Rep: Putative uncharacterized protein SCO5717 - Streptomyces coelicolor Length = 1083 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 872 FFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 F PPPP G PPPP PG P P P Sbjct: 112 FTPPPPAPAPGAAFTPPPPPGPGAPFTPPAPPSGGP 147 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 35.1 bits (77), Expect = 3.2 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP GG PPPPPP P PPP P Sbjct: 92 PPPPPPPAGG---MPPPPPPPMGGGAP-PPPPGP 121 >UniRef50_A5V8M1 Cluster: OmpA/MotB domain protein precursor; n=3; Sphingomonadales|Rep: OmpA/MotB domain protein precursor - Sphingomonas wittichii RW1 Length = 373 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 824 PPPPPPGXXXXXPXXPPPXPXXXXXXXFFFFF 729 PPPPPP P PPP P F FF Sbjct: 239 PPPPPPPPPPPPPPPPPPPPVVETPGPFIVFF 270 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 824 PPPPPPGXXXXXPXXPPPXPXXXXXXXFFFFFF 726 PPPPPP P PPP P F FF Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPVVETPGPFIVFF 270 >UniRef50_Q6F2W0 Cluster: Putative Dof zinc finger protein; n=2; Oryza sativa|Rep: Putative Dof zinc finger protein - Oryza sativa subsp. japonica (Rice) Length = 371 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 P GG G PPPPPP P PPP Sbjct: 12 PRKGAGGGGTTTPPPPPPAQQQQQQPLPPPP 42 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 196 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 229 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 184 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 217 Score = 34.3 bits (75), Expect = 5.6 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 1/69 (1%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPP-PPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXX 691 SPPP PP PPPP PP PPP Sbjct: 174 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 233 Query: 690 KKXPXPPPP 664 P PPPP Sbjct: 234 PPSPPPPPP 242 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 204 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 237 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 209 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 242 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 216 SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP P PPPP PP PPP Sbjct: 221 SPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 226 SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 >UniRef50_Q2RAC3 Cluster: Harpin-induced protein 1 containing protein, expressed; n=2; Oryza sativa (japonica cultivar-group)|Rep: Harpin-induced protein 1 containing protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 342 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP PPPPPP P PPP Sbjct: 120 PPPPPPHAYHHHHYPPPPPPHHHPYPPHPPPP 151 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 73 PPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSP 106 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 S PP G PPPPP PP PPP Sbjct: 59 SSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPP 91 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 833 PPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAP 866 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 791 PPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPP 824 >UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 17 contig 1, DNA sequence - Ostreococcus tauri Length = 281 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 118 PPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSP 151 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 117 SPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPP 149 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPP P PP PPP Sbjct: 122 SPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP 154 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 920 PPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSP 952 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 SPPP PPPPPP PP PPP Sbjct: 919 SPPPPSPPSPSPPSPPPPPP-VPSPPPPSPPPP 950 >UniRef50_A3BQ84 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 2240 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPP 456 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEP 458 >UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|Rep: CG1520-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 527 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 +PPP PPPPPP PP PP Sbjct: 369 APPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 >UniRef50_Q54CQ8 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 910 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 872 FFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 F PPPP G PPPPPG P PPP Sbjct: 719 FAPPPPPMMSSG-----PPPPPGSSFGAPPPPPP 747 >UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|Rep: CG12946-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 630 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 +PPP G G PPPPPP P PP Sbjct: 512 APPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 543 >UniRef50_Q6FIZ5 Cluster: Similarity; n=1; Candida glabrata|Rep: Similarity - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1665 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP + PPPPP G P PPP Sbjct: 1114 PPPPPPHGQLKKKPPPPPPQGQLKKKPPPPPP 1145 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G PPPPPP P PPP Sbjct: 1113 TPPPPPPHGQLKKKPPPPPPQGQLKKKPPPPPP 1145 >UniRef50_Q5ANI0 Cluster: Potential fungal zinc cluster transcription factor; n=1; Candida albicans|Rep: Potential fungal zinc cluster transcription factor - Candida albicans (Yeast) Length = 1130 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 876 FFFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPP 772 F F PPP G P PPPP PP PP Sbjct: 333 FGFPPPPPGPPGPPGPPPVPPPPHYHQSAPPESPP 367 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP P P P P Sbjct: 128 PPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKP 161 >UniRef50_Q0UAV3 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 636 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 873 FFSPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 F PPP G PPPPPP PP PPP Sbjct: 539 FPPPPPFQPGAFPGGIPPPPPPNYIGPFPP--PPP 571 Score = 35.1 bits (77), Expect = 3.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 869 FPPPPXXXXGGXEXX-PPPPPPGXXXXXPXXPP 774 FPPPP G PPPPPP P PP Sbjct: 539 FPPPPPFQPGAFPGGIPPPPPPNYIGPFPPPPP 571 >UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 996 Score = 35.1 bits (77), Expect = 3.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP P PPP P Sbjct: 949 PPPPSLIPFGASPPPPPPPP------PPPPPPPP 976 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 35.1 bits (77), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P P P P Sbjct: 161 PPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSP 194 >UniRef50_Q9LS95 Cluster: Somatic embryogenesis receptor kinase-like protein; n=7; core eudicotyledons|Rep: Somatic embryogenesis receptor kinase-like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 714 Score = 31.9 bits (69), Expect(2) = 3.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 825 PPPPPPXXXXXXPPXXPPP 769 PPPPPP PP PPP Sbjct: 267 PPPPPPGSWQPSPPPPPPP 285 Score = 21.8 bits (44), Expect(2) = 3.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 681 PXPPPPXXGG 652 P PPPP GG Sbjct: 280 PPPPPPVSGG 289 >UniRef50_Q2GSB8 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 255 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 875 FFFPPPPXXXXGGXEXXPPPPPPG 804 F PPPP GG PPPPP G Sbjct: 217 FPMPPPPQPTPGGMPPPPPPPPGG 240 Score = 29.9 bits (64), Expect(2) = 3.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 837 GXXXPPPPPPXXXXXXPPXXPPP 769 G PPPP P PP PPP Sbjct: 216 GFPMPPPPQPTPGGMPPPPPPPP 238 Score = 23.8 bits (49), Expect(2) = 3.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 681 PXPPPPXXGGXF 646 P PPPP GG F Sbjct: 231 PPPPPPPPGGHF 242 >UniRef50_UPI00015B5CAE Cluster: PREDICTED: similar to conserved hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to conserved hypothetical protein - Nasonia vitripennis Length = 1774 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP P PPP Sbjct: 291 PPPPPLLISG----PPPPPPNAFMDPPPLPPP 318 >UniRef50_UPI00006A1328 Cluster: C219-reactive peptide; n=4; Tetrapoda|Rep: C219-reactive peptide - Xenopus tropicalis Length = 612 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 872 FFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 F PPPP G + P PPPPG P PPP Sbjct: 576 FGPPPP----GVRDFPPGPPPPGVRDFPPGPPPP 605 >UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n=2; Rattus norvegicus|Rep: UPI0000DC1448 UniRef100 entry - Rattus norvegicus Length = 319 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 164 PPPPPSPSSLSSPLPPPPPLSPSPPPPPPPPPPP 197 >UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; Gallus gallus|Rep: Putative uncharacterized protein - Gallus gallus (Chicken) Length = 1266 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP G PPPPPP PP PPP Sbjct: 682 PPPLPMVPGCPPPPPPPPVVPGCPPPPPPPP 712 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP G PPPPPP P PPP P Sbjct: 682 PPPLPMVPGCP--PPPPPPPVVPGCPPPPPPPP 712 >UniRef50_Q684D7 Cluster: Putative uncharacterized protein; n=1; Sulfolobus virus STSV1|Rep: Putative uncharacterized protein - Sulfolobus virus STSV1 Length = 757 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 772 GGGXXGXXLSXPGGGGGGXXSXPPXXXXGGGGKKKN 879 GGG S G GGGG S PP GGG N Sbjct: 187 GGGGSSNPNSGGGSGGGGGSSSPPNSGGGGGNNNPN 222 >UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2; Hyphomonadaceae|Rep: OmpA/MotB domain protein precursor - Maricaulis maris (strain MCS10) Length = 359 Score = 34.7 bits (76), Expect = 4.2 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -2 Query: 875 FFFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXPXXXXXXXFFFFF 729 F PPPP PPPPPP P PPP P F +F Sbjct: 213 FAAPPPPPPPP-----PPPPPPPPPPPPPPPPPPPPPPACDDVSFPVYF 256 >UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like protein precursor; n=5; Mycobacterium|Rep: U5 snRNP spliceosome subunit-like protein precursor - Mycobacterium sp. (strain JLS) Length = 137 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPPG P PPP P Sbjct: 83 PPPPPP--------PPPPPPGAPPPPPPPPPPPP 108 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP PPP Sbjct: 86 PPPPPPPPPGAPPPPPPPPPPPPPPVYVPPPP 117 Score = 33.5 bits (73), Expect = 9.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PP P Sbjct: 84 PPPPPPPPPPPGAPPPPPPPPPPPPPPVYVPPPP 117 >UniRef50_A0W7U9 Cluster: Putative uncharacterized protein precursor; n=1; Geobacter lovleyi SZ|Rep: Putative uncharacterized protein precursor - Geobacter lovleyi SZ Length = 227 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PP P + PPPPPP P PPP P Sbjct: 55 PPKPAPKPEVDKFVPPPPPPPRYEAPPVAPPPRP 88 >UniRef50_A0PNV4 Cluster: Sensor protein; n=3; Mycobacterium|Rep: Sensor protein - Mycobacterium ulcerans (strain Agy99) Length = 506 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -2 Query: 863 PPPXXXXGGXE--XXPPPPPPGXXXXXPXXPPP 771 PPP GG + PPPPPP P PPP Sbjct: 119 PPPLIPPGGHQGPHGPPPPPPPPPGGPPPGPPP 151 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP GG PPPPP PP PPP Sbjct: 120 PPLIPPGGHQGPHGPPPPPPPPPGGPPPGPPP 151 >UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thaliana|Rep: F7H2.17 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 1006 Score = 34.7 bits (76), Expect = 4.2 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXPXXXXXXXFFFFFFLXXXXXXXXXXXK 687 P PP P PPPP P PPP P FFFF Sbjct: 133 PCPPPLMPSPPPLVPSPPPPPPSPLVPSPPPPSPPP-------FFFFPSPPPPVIVFPPP 185 Query: 686 XXPXPXPXXGGG 651 P P P GG Sbjct: 186 LVPSPPPPLPGG 197 >UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza sativa|Rep: Diaphanous homologue-like - Oryza sativa subsp. japonica (Rice) Length = 1391 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP G PPPPPP P PPP Sbjct: 775 PPPMIPGMKTPPTPPPPPPAAPGQQAPAVPPP 806 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 34.7 bits (76), Expect = 4.2 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPPXXXXXXXXXXXXXXFVXGGGXXXXXXKK 685 PPP PPPPP PP PPP GG Sbjct: 369 PPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLG---T 425 Query: 684 XPXPPPP 664 P PPPP Sbjct: 426 RPPPPPP 432 >UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg protein - Ostreococcus tauri Length = 3738 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PP PPP P PPP P Sbjct: 13 PPPPPSPPPPPSPAPPSPPPPPPSPPPPSPPPPP 46 >UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 786 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 621 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSP 654 >UniRef50_Q93107 Cluster: Myosin I heavy chain kinase; n=1; Acanthamoeba castellanii|Rep: Myosin I heavy chain kinase - Acanthamoeba castellanii (Amoeba) Length = 753 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP PPP P Sbjct: 161 PPPPGGSAAFVDDEPPPPPPPRDDGEFEAPPPPP 194 >UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms|Rep: Ah1644 protein - Drosophila melanogaster (Fruit fly) Length = 1644 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPP P PPP Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 867 SPPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 +PPP G PPPPPP P PPP Sbjct: 282 APPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP GG PPPPP P P P Sbjct: 297 PPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 Score = 33.5 bits (73), Expect = 9.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PPPPPP PPP P Sbjct: 284 PPPPPPINGA---APPPPPPPMINGGALPPPPPP 314 >UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 354 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPPP G PPPPPP PPP Sbjct: 111 PPPPPPPMTGVPPPPPPPPPPPISKSNIPPPP 142 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 94 PPPPTAAATTSSNIPPPPPPPPPPMTGVPPPPPP 127 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP G PPPPPP PP PPP Sbjct: 650 PPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPP 681 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPP 771 PPP GG + PPPPPP P PPP Sbjct: 654 PPPT---GGPKQPPPPPPPPPPPPPPPPPPP 681 >UniRef50_Q1HMI9 Cluster: Formin C; n=3; Trypanosoma cruzi|Rep: Formin C - Trypanosoma cruzi strain CL Brener Length = 937 Score = 34.7 bits (76), Expect = 4.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP 807 PPPP GG + PPPPPP Sbjct: 476 PPPPPTSAGGKKGAPPPPPP 495 Score = 33.9 bits (74), Expect = 7.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPP 784 PPP GG PPPPPP PP Sbjct: 478 PPPTSAGGKKGAPPPPPPPPSGAKKPP 504 >UniRef50_Q00486 Cluster: Mini-collagen precursor; n=2; Hydra sp.|Rep: Mini-collagen precursor - Hydra sp Length = 186 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 861 PPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PP GG G PP PP PP PPP Sbjct: 113 PPGGPGGPGMPGPPGPPGPPGIPAPPAPPPP 143 >UniRef50_A0CRC9 Cluster: Chromosome undetermined scaffold_25, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_25, whole genome shotgun sequence - Paramecium tetraurelia Length = 1300 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 777 PPPEPPTVKVAPPPPPPPPPSLKPGGPPPPPPPP 810 >UniRef50_Q2H9M3 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 346 Score = 34.7 bits (76), Expect = 4.2 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP + PPPPPP P PPP P Sbjct: 182 PPPPSPPAAPPQTPPPPPPP----TNPPPPPPPP 211 >UniRef50_Q2H982 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 173 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -2 Query: 869 FPPPPXXXXGGXEXXP--PPPPPGXXXXXPXXPPPXP 765 F P P GG P PPPPP P PPP P Sbjct: 86 FGPEPGYGGGGSSPRPQPPPPPPPPQPGLPPPPPPPP 122 >UniRef50_A6RUF2 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 743 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP G PP PPP P PP P Sbjct: 148 PPPPGRKDGADGRTPPVPPPAGKPKPPGLPPRLP 181 >UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 536 Score = 34.7 bits (76), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 435 PPPPPPPPPPPSPPAPPPPPPPPVITPPPPPPTP 468 >UniRef50_Q8TF74 Cluster: WAS/WASL-interacting protein family member 2; n=10; Eutheria|Rep: WAS/WASL-interacting protein family member 2 - Homo sapiens (Human) Length = 440 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPP----GXXXXXPXXPPPXP 765 PPPP G PPPPPP G PPP P Sbjct: 326 PPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPP 363 Score = 34.7 bits (76), Expect = 4.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP---PPPPPGXXXXXPXXPPPXP 765 PPPP G E PPPPP P PPP P Sbjct: 341 PPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPP 377 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP PPP P Sbjct: 311 PPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPP 344 >UniRef50_A7TK46 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 1047 Score = 27.5 bits (58), Expect(2) = 4.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 824 PPPPPPGXXXXXPXXPPPXP 765 PPPPPPG PP P Sbjct: 742 PPPPPPGTSMEPMQAPPKIP 761 Score = 25.8 bits (54), Expect(2) = 4.6 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPP 810 PPPP PPPPP Sbjct: 705 PPPPPPHITASRAPPPPPP 723 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 34.3 bits (75), Expect = 5.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPPP P PPP P Sbjct: 914 PPPPPLL--SEAPLPPPPPPPPQAALPPPPPPGP 945 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPP-PPPPGXXXXXPXXPPPXP 765 PP P G PP PPPP P PPP P Sbjct: 897 PPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPP 931 >UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein cappuccino; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Protein cappuccino - Tribolium castaneum Length = 1011 Score = 34.3 bits (75), Expect = 5.6 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 7/78 (8%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXP-------PPXXXXXXXXXXXXXXFVXGGGX 706 PPP G G PPPPP PP P PP GG Sbjct: 461 PPPPPMPGIGA---PPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPP 517 Query: 705 XXXXXKKXPXPPPPXXGG 652 P PPPP GG Sbjct: 518 PPPMPGTGPPPPPPPMGG 535 >UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi|Rep: formin-like 2 - Xenopus tropicalis Length = 1054 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 P PP PPPPPP P PPP P Sbjct: 532 PSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 565 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPP P P PPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPP 568 Score = 33.9 bits (74), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 863 PPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPP PPPPPP P PPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPP 566 Score = 33.5 bits (73), Expect = 9.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 858 PXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 P G PPPPPP PP PPP Sbjct: 523 PLENGPVSAPSPPPPPPPPPPPPPPPPPPP 552 >UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 13 SCAF15000, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 307 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 864 PPPXXXGGXGXXXPPPPPPXXXXXXPPXXPPP 769 PPP PPPPPP PP PPP Sbjct: 179 PPPFPLFPLFPPPPPPPPPPPFSPPPPPSPPP 210 >UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: All3916 protein - Anabaena sp. (strain PCC 7120) Length = 383 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP P PPPP P PPP P Sbjct: 324 PPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPP 357 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPPPP P PPP P Sbjct: 346 PPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEP 379 Score = 33.9 bits (74), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 866 PPPPXXXXGGXEXXP-PPPPPGXXXXXPXXPPPXP 765 PPPP P PPPPP P PPP P Sbjct: 330 PPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPP 364 >UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC0732; n=2; Xanthomonas|Rep: Putative uncharacterized protein XAC0732 - Xanthomonas axonopodis pv. citri Length = 266 Score = 34.3 bits (75), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 872 FFPPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 F PPPP PPPPPP P PPP P Sbjct: 230 FAPPPPPPPPPPPPPPPPPPPP----PPPPPPPPPP 261 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSP 124 Score = 34.3 bits (75), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 866 PPPPXXXXGGXEXXPPPPPPGXXXXXPXXPPPXP 765 PPPP PPP PP P PPP P Sbjct: 96 PPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 129 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,455,340 Number of Sequences: 1657284 Number of extensions: 11042338 Number of successful extensions: 226195 Number of sequences better than 10.0: 337 Number of HSP's better than 10.0 without gapping: 29901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120835 length of database: 575,637,011 effective HSP length: 102 effective length of database: 406,594,043 effective search space used: 106121045223 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -