BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_K21 (932 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC18B11.02c |||pseudouridylate synthase |Schizosaccharomyces p... 28 2.2 SPAC17A2.14 ||SPAC17G6.01|CorA family magnesium ion transporter|... 27 5.0 >SPAC18B11.02c |||pseudouridylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 27.9 bits (59), Expect = 2.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 110 YYNFITFIKVRIYSRLQLALFTNQMPKSET 199 YY +ITF K+R Y + L +F + E+ Sbjct: 29 YYEYITFAKLRWYGKTLLEVFNTEFRDRES 58 >SPAC17A2.14 ||SPAC17G6.01|CorA family magnesium ion transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 617 Score = 26.6 bits (56), Expect = 5.0 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 136 SKNIQSFTIGFIYKSNAQI*NHSNFREKHVGAACQTVFPFFP 261 S +S GF YK NA++ N F ++ + + FP P Sbjct: 3 SNTSRSVPTGFYYKQNARMQNRPRFSDRKHSSKSKHRFPVDP 44 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,416,068 Number of Sequences: 5004 Number of extensions: 66273 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 473333082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -