BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_K21 (932 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) 30 3.1 SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_31477| Best HMM Match : TPR_div1 (HMM E-Value=3.5e-34) 28 9.4 >SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) Length = 1632 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/65 (24%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Frame = +3 Query: 186 PNLKPFKLSRETCWSGVPNCFSVLPPLENSARNSTVPCMTKPXKGISNCINHV-APCRPL 362 P + P K++ C V C + P + + S PC+ ++ C++ V P Sbjct: 540 PCVDPVKVAVTPCVDPVTPCVDPVTPYVDPVKVSVTPCVDPVKVAVTPCVDPVKVPSESG 599 Query: 363 SSTCC 377 S T C Sbjct: 600 SDTLC 604 >SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 855 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 715 GRVXGGKYTHXGRTQNPVKESXSDVPRXXXGNICNXIKXXNGG 843 G G KY + G+ P K + ++ R GN C +K NGG Sbjct: 676 GCTRGMKYGYLGKESRP-KINRTNGTRVGCGNACAVLKCRNGG 717 >SB_42203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/59 (23%), Positives = 24/59 (40%) Frame = -1 Query: 362 QWPTWGNVVDAVRDTFXRFRHTWNCAIPRTIFQRGKNGKTVWHAAPTCFSRKFEWFQIW 186 +W W + + + R+ WN A+ R N W+ A C R++ W+ W Sbjct: 108 RWLAWNPALLCLMRQYNRWL-AWNPAL--LCLMRQYNRWLAWNPALLCLMRQYNWWLAW 163 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/59 (23%), Positives = 24/59 (40%) Frame = -1 Query: 362 QWPTWGNVVDAVRDTFXRFRHTWNCAIPRTIFQRGKNGKTVWHAAPTCFSRKFEWFQIW 186 +W W + + + R+ WN A+ R N W+ A C R++ W+ W Sbjct: 125 RWLAWNPALLCLMRQYNRWL-AWNPAL--LCLMRQYNWWLAWNPALLCLMRQYNWWLAW 180 >SB_31477| Best HMM Match : TPR_div1 (HMM E-Value=3.5e-34) Length = 162 Score = 28.3 bits (60), Expect = 9.4 Identities = 10/33 (30%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +2 Query: 578 EERMXXTWDHALSWPSNDYDRYFXI-QXXPTPE 673 ++ + +D+ ++ P+ND+D Y+ I + PTP+ Sbjct: 92 DDDLLQQYDYLINQPTNDWDLYYWITENKPTPD 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,716,066 Number of Sequences: 59808 Number of extensions: 503647 Number of successful extensions: 929 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 929 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2717121828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -