BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_K16 (995 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 24 2.1 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 6.4 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 22 6.4 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 8.5 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.8 bits (49), Expect = 2.1 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -2 Query: 886 VYSFNNSSILSSMYDRIPEKLTSIPFTQYGKGXYFFPFLAAC 761 +Y + + S ++ IP LTS+ + G + F F AC Sbjct: 489 IYFISKTLAESPIFIIIPVTLTSVCYFMIGLNSHGFRFYIAC 530 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 354 WLPQVSSKGKETPFXPGWGLMVPFLXANWAQXFSPFFK 241 +L S K TP P G + L A + +PFF+ Sbjct: 229 YLQAASMLPKPTPLVPQQGFNMERLLAPSTEVSAPFFR 266 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 22.2 bits (45), Expect = 6.4 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = -3 Query: 882 ILSIIRQFYPPCTIGYQK-----NLRPFLSHNMVR 793 +L +++Q Y I Q+ NL PFL HN++R Sbjct: 110 VLHVVKQCYHLQKINVQQSGIFINL-PFLEHNLIR 143 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 8.5 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -2 Query: 886 VYSFNNSSILSSMYDRIPEKLTSIPFTQYGKGXYFFPFLAAC 761 +Y + + S ++ IP LTS+ + G F F AC Sbjct: 489 IYFISKTLAESPIFIIIPVILTSVCYFMIGLNSQGFRFYIAC 530 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,645 Number of Sequences: 336 Number of extensions: 4424 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 28340642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -