BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_K12 (903 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0162 - 1394980-1395760,1396024-1396037 29 6.7 01_01_0159 + 1380421-1381143 29 6.7 10_03_0021 + 7129786-7130117,7130227-7130347,7131048-7131136,713... 28 8.8 04_01_0080 - 889548-889892 28 8.8 >01_01_0162 - 1394980-1395760,1396024-1396037 Length = 264 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/51 (31%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +3 Query: 153 RKCPKGEHSVLY-----CPQMAEPDCENPEVHDFVDHVGPCDVPQCFCDRP 290 R+C +H +LY CP A HD H C CFC P Sbjct: 33 RRCVAVDH-ILYAITVPCPNAAHGCAARTPYHDSHGHAAGCPHAPCFCPEP 82 >01_01_0159 + 1380421-1381143 Length = 240 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/51 (31%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +3 Query: 153 RKCPKGEHSVLY-----CPQMAEPDCENPEVHDFVDHVGPCDVPQCFCDRP 290 R+C +H +LY CP A HD H C CFC P Sbjct: 9 RRCVAVDH-ILYAITVPCPNAAHGCAARTPYHDSHGHAAGCPHAPCFCPEP 58 >10_03_0021 + 7129786-7130117,7130227-7130347,7131048-7131136, 7131375-7131459,7131609-7131771,7132861-7132937, 7133016-7133160,7133236-7133537,7133615-7133720, 7134781-7134935,7135556-7135712,7135799-7135891, 7136232-7136359,7136439-7136696,7136855-7137145, 7137235-7137318,7138335-7138468,7138557-7138784, 7139778-7139958,7140021-7140108,7140268-7140434, 7140750-7141012,7141117-7141120 Length = 1216 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 190 ALKWPSRTVRIPKSTISLTTWAHATYHSASATGLMS-GTRKL 312 A P+ +RIP S I W+ Y++ S +G M+ GT L Sbjct: 498 AFSLPNWILRIPYSFIEAVVWSCVVYYTVSVSGNMTVGTNIL 539 >04_01_0080 - 889548-889892 Length = 114 Score = 28.3 bits (60), Expect = 8.8 Identities = 6/20 (30%), Positives = 16/20 (80%) Frame = -1 Query: 360 IDLHNFINIQIPVHICQFSC 301 +D+H+++N+ + + +C+F C Sbjct: 84 VDIHDYLNLALHMQLCRFGC 103 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,588,981 Number of Sequences: 37544 Number of extensions: 426503 Number of successful extensions: 1090 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1079 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2553813320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -